Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4V318

Protein Details
Accession E4V318    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-63GVVRRGAKTKKENRRTRPHPAVMNHydrophilic
NLS Segment(s)
PositionSequence
43-56RRGAKTKKENRRTR
Subcellular Location(s) nucl 12, cyto_nucl 11.333, cyto 8.5, cyto_pero 7.166, pero 4.5
Family & Domain DBs
Amino Acid Sequences MTFLYDVKSVYVHEFDRGVVSDQDGTMNDDVSPIPGPINGVVRRGAKTKKENRRTRPHPAVMNGNPSAGDAMPQAVYPKPEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.17
5 0.17
6 0.14
7 0.14
8 0.13
9 0.13
10 0.13
11 0.12
12 0.13
13 0.11
14 0.11
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.13
26 0.12
27 0.13
28 0.15
29 0.17
30 0.18
31 0.22
32 0.25
33 0.27
34 0.37
35 0.46
36 0.54
37 0.63
38 0.72
39 0.77
40 0.84
41 0.84
42 0.85
43 0.85
44 0.8
45 0.76
46 0.7
47 0.7
48 0.62
49 0.62
50 0.52
51 0.42
52 0.35
53 0.3
54 0.26
55 0.17
56 0.14
57 0.08
58 0.09
59 0.09
60 0.09
61 0.11
62 0.12