Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369JKS2

Protein Details
Accession A0A369JKS2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
286-314AAGPSTTAPYRRRRRGRRAGTRLPKDEQEHydrophilic
NLS Segment(s)
PositionSequence
296-308RRRRRGRRAGTRL
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MSLCAASSSRLQHLMKLGSRVLQDGHNSARCPPIPDRADAPRANPVIPHLDGLSDRPYVWLPPIVDTNPPTVTIPQDFAHLHLPRPIAEGSLSRPHKLTFVRPGRHPTDEIIVGVAEARVIGQDAPEVAPSSLDVQRRLQACSKVGEDLPATTLGGEVESVKSASSAPGLPTWDTSYLNFLAAIGQRALASSFPSMPLPPVPLSTSLPSSHEPWPLAPTPFSQPAALPTTNVDAVATRPSLVNRLANPLVDRLADPPRSLLQRMDQQSELEADIQVAPESDGNSPAAGPSTTAPYRRRRRGRRAGTRLPKDEQEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.41
4 0.39
5 0.36
6 0.36
7 0.34
8 0.3
9 0.26
10 0.26
11 0.26
12 0.32
13 0.32
14 0.32
15 0.32
16 0.38
17 0.36
18 0.38
19 0.37
20 0.4
21 0.39
22 0.41
23 0.44
24 0.44
25 0.51
26 0.46
27 0.46
28 0.44
29 0.43
30 0.4
31 0.35
32 0.31
33 0.29
34 0.28
35 0.26
36 0.18
37 0.18
38 0.18
39 0.2
40 0.2
41 0.15
42 0.15
43 0.15
44 0.16
45 0.15
46 0.17
47 0.19
48 0.16
49 0.18
50 0.21
51 0.21
52 0.24
53 0.24
54 0.26
55 0.22
56 0.22
57 0.21
58 0.18
59 0.2
60 0.18
61 0.2
62 0.16
63 0.19
64 0.18
65 0.19
66 0.26
67 0.24
68 0.23
69 0.25
70 0.25
71 0.22
72 0.25
73 0.23
74 0.15
75 0.15
76 0.16
77 0.16
78 0.25
79 0.26
80 0.24
81 0.25
82 0.25
83 0.28
84 0.29
85 0.31
86 0.32
87 0.4
88 0.44
89 0.47
90 0.53
91 0.53
92 0.54
93 0.49
94 0.4
95 0.35
96 0.3
97 0.26
98 0.2
99 0.15
100 0.12
101 0.11
102 0.09
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.04
112 0.05
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.09
119 0.12
120 0.14
121 0.15
122 0.16
123 0.2
124 0.21
125 0.23
126 0.24
127 0.24
128 0.24
129 0.24
130 0.24
131 0.21
132 0.2
133 0.19
134 0.15
135 0.12
136 0.12
137 0.09
138 0.08
139 0.06
140 0.07
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.05
151 0.05
152 0.05
153 0.06
154 0.07
155 0.08
156 0.09
157 0.09
158 0.1
159 0.12
160 0.12
161 0.12
162 0.11
163 0.13
164 0.12
165 0.12
166 0.11
167 0.09
168 0.1
169 0.1
170 0.1
171 0.07
172 0.07
173 0.07
174 0.07
175 0.08
176 0.06
177 0.07
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.09
184 0.1
185 0.11
186 0.11
187 0.12
188 0.12
189 0.14
190 0.16
191 0.16
192 0.18
193 0.16
194 0.19
195 0.19
196 0.21
197 0.22
198 0.24
199 0.23
200 0.21
201 0.25
202 0.25
203 0.24
204 0.22
205 0.21
206 0.22
207 0.25
208 0.26
209 0.22
210 0.19
211 0.22
212 0.26
213 0.24
214 0.19
215 0.17
216 0.18
217 0.18
218 0.18
219 0.14
220 0.09
221 0.1
222 0.13
223 0.12
224 0.09
225 0.1
226 0.11
227 0.14
228 0.16
229 0.19
230 0.18
231 0.24
232 0.25
233 0.25
234 0.26
235 0.24
236 0.23
237 0.2
238 0.19
239 0.16
240 0.22
241 0.22
242 0.21
243 0.22
244 0.26
245 0.28
246 0.29
247 0.28
248 0.28
249 0.35
250 0.39
251 0.41
252 0.37
253 0.34
254 0.34
255 0.33
256 0.28
257 0.2
258 0.15
259 0.12
260 0.11
261 0.11
262 0.1
263 0.08
264 0.08
265 0.08
266 0.1
267 0.1
268 0.11
269 0.11
270 0.11
271 0.11
272 0.1
273 0.11
274 0.1
275 0.1
276 0.1
277 0.17
278 0.2
279 0.27
280 0.33
281 0.42
282 0.53
283 0.63
284 0.73
285 0.76
286 0.84
287 0.89
288 0.93
289 0.94
290 0.94
291 0.94
292 0.94
293 0.94
294 0.89
295 0.83