Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UYN5

Protein Details
Accession E4UYN5   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-33PLKLSRKKGHTAKFLPRRHQKNRRDNIMGIHydrophilic
NLS Segment(s)
PositionSequence
8-52SRKKGHTAKFLPRRHQKNRRDNIMGITNKASKTAKPAIRRLARRG
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDVPLKLSRKKGHTAKFLPRRHQKNRRDNIMGITNKASKTAKPAIRRLARRGGVVRIQKAIYKTVREIVVSRLETILEQVVMLLESTDTSRKARKTVTTSDIVFVLKRLGTTVYGFDNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.79
4 0.81
5 0.82
6 0.83
7 0.84
8 0.85
9 0.87
10 0.87
11 0.88
12 0.9
13 0.88
14 0.84
15 0.75
16 0.7
17 0.69
18 0.59
19 0.51
20 0.44
21 0.38
22 0.32
23 0.34
24 0.29
25 0.2
26 0.25
27 0.32
28 0.34
29 0.37
30 0.43
31 0.49
32 0.57
33 0.6
34 0.59
35 0.59
36 0.55
37 0.52
38 0.48
39 0.42
40 0.41
41 0.4
42 0.36
43 0.3
44 0.28
45 0.27
46 0.26
47 0.27
48 0.22
49 0.2
50 0.2
51 0.21
52 0.21
53 0.2
54 0.2
55 0.18
56 0.22
57 0.2
58 0.2
59 0.17
60 0.16
61 0.15
62 0.15
63 0.12
64 0.06
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.03
72 0.03
73 0.05
74 0.07
75 0.08
76 0.11
77 0.17
78 0.19
79 0.23
80 0.27
81 0.34
82 0.39
83 0.45
84 0.48
85 0.48
86 0.48
87 0.45
88 0.42
89 0.35
90 0.29
91 0.21
92 0.19
93 0.13
94 0.12
95 0.12
96 0.12
97 0.13
98 0.15
99 0.17