Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369K1S2

Protein Details
Accession A0A369K1S2    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-70VVLLRKFLRRNQRRMRQRQSNAYSCTQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, extr 3, cyto_nucl 2, E.R. 2, nucl 1.5, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKAAYDRRLKQVLIHATKRFLVTLCTHAASVEPASVFCVSILNVVLLRKFLRRNQRRMRQRQSNAYSCTQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.48
4 0.5
5 0.46
6 0.38
7 0.28
8 0.23
9 0.19
10 0.2
11 0.19
12 0.18
13 0.17
14 0.16
15 0.16
16 0.14
17 0.12
18 0.09
19 0.07
20 0.06
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.05
27 0.06
28 0.06
29 0.05
30 0.06
31 0.07
32 0.07
33 0.08
34 0.09
35 0.12
36 0.16
37 0.23
38 0.33
39 0.42
40 0.53
41 0.62
42 0.72
43 0.79
44 0.86
45 0.91
46 0.9
47 0.9
48 0.91
49 0.89
50 0.86
51 0.81