Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369JGY2

Protein Details
Accession A0A369JGY2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-95SVLLRHKWDRFQQKRKEHLRGLDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11, extr 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0009306  P:protein secretion  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences MALATPFRAPAPVAFRSLTLRSEHLSPCSTMVAPVLLSRGLDPFLGIFTGFFAYYLHETHPRTALPPDERLSVLLRHKWDRFQQKRKEHLRGLDSGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.28
4 0.29
5 0.26
6 0.23
7 0.23
8 0.22
9 0.25
10 0.25
11 0.24
12 0.24
13 0.22
14 0.21
15 0.2
16 0.19
17 0.15
18 0.13
19 0.11
20 0.09
21 0.09
22 0.08
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.07
42 0.08
43 0.09
44 0.13
45 0.14
46 0.16
47 0.18
48 0.17
49 0.17
50 0.19
51 0.23
52 0.21
53 0.25
54 0.26
55 0.26
56 0.26
57 0.26
58 0.26
59 0.25
60 0.27
61 0.27
62 0.3
63 0.34
64 0.36
65 0.41
66 0.48
67 0.55
68 0.61
69 0.66
70 0.72
71 0.76
72 0.84
73 0.87
74 0.88
75 0.84
76 0.82
77 0.77
78 0.71