Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369J850

Protein Details
Accession A0A369J850   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
140-169CTPFIRKQPKRASPAKPRQKEPRNAPRHHVHydrophilic
NLS Segment(s)
PositionSequence
145-181RKQPKRASPAKPRQKEPRNAPRHHVQPARAKRNRHSI
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGRWTQYDEDAYGFPNGMRRTAYDADTKQYTYTTSGLNPPPSRWPYSYYSQPARLPPPKPIVREKQPKNEKSLPDAPPPLSPRTRSTEINKLLPILPPNFTIPTDAELEKYPRGSFAASWRKLSSLNIPSAVRSLRRAVCTPFIRKQPKRASPAKPRQKEPRNAPRHHVQPARAKRNRHSIMSHNRWRKVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.19
4 0.18
5 0.18
6 0.18
7 0.25
8 0.28
9 0.3
10 0.31
11 0.32
12 0.35
13 0.37
14 0.36
15 0.29
16 0.27
17 0.26
18 0.2
19 0.2
20 0.17
21 0.17
22 0.23
23 0.26
24 0.34
25 0.34
26 0.33
27 0.4
28 0.42
29 0.44
30 0.39
31 0.4
32 0.37
33 0.42
34 0.48
35 0.46
36 0.48
37 0.48
38 0.49
39 0.49
40 0.53
41 0.53
42 0.47
43 0.46
44 0.5
45 0.5
46 0.52
47 0.56
48 0.56
49 0.59
50 0.68
51 0.69
52 0.7
53 0.75
54 0.73
55 0.74
56 0.72
57 0.64
58 0.61
59 0.62
60 0.55
61 0.51
62 0.51
63 0.43
64 0.41
65 0.41
66 0.38
67 0.33
68 0.31
69 0.3
70 0.34
71 0.36
72 0.36
73 0.38
74 0.42
75 0.43
76 0.43
77 0.39
78 0.34
79 0.31
80 0.28
81 0.25
82 0.17
83 0.15
84 0.13
85 0.15
86 0.14
87 0.14
88 0.14
89 0.12
90 0.13
91 0.14
92 0.13
93 0.13
94 0.13
95 0.15
96 0.14
97 0.15
98 0.13
99 0.11
100 0.12
101 0.11
102 0.11
103 0.19
104 0.28
105 0.29
106 0.32
107 0.31
108 0.31
109 0.32
110 0.32
111 0.31
112 0.25
113 0.26
114 0.26
115 0.26
116 0.26
117 0.27
118 0.27
119 0.21
120 0.18
121 0.22
122 0.23
123 0.26
124 0.28
125 0.29
126 0.36
127 0.41
128 0.45
129 0.46
130 0.52
131 0.59
132 0.61
133 0.68
134 0.7
135 0.73
136 0.74
137 0.77
138 0.77
139 0.78
140 0.84
141 0.85
142 0.82
143 0.82
144 0.85
145 0.86
146 0.86
147 0.85
148 0.85
149 0.85
150 0.81
151 0.8
152 0.78
153 0.75
154 0.75
155 0.7
156 0.66
157 0.67
158 0.73
159 0.78
160 0.75
161 0.74
162 0.73
163 0.78
164 0.76
165 0.71
166 0.66
167 0.66
168 0.71
169 0.75
170 0.77
171 0.75