Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369J1E3

Protein Details
Accession A0A369J1E3    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-73GTPLKDLRVPWRKKPSRGRCDYVRPIDHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPHQLGTQLLRLAPPRPKNLEERSSAFGSMPLMTDEPMGRADPLRGTPLKDLRVPWRKKPSRGRCDYVRPIDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.43
4 0.46
5 0.51
6 0.57
7 0.57
8 0.54
9 0.51
10 0.49
11 0.44
12 0.41
13 0.33
14 0.26
15 0.21
16 0.16
17 0.13
18 0.09
19 0.08
20 0.07
21 0.08
22 0.07
23 0.07
24 0.08
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.09
31 0.13
32 0.13
33 0.15
34 0.2
35 0.25
36 0.27
37 0.28
38 0.31
39 0.37
40 0.46
41 0.5
42 0.54
43 0.6
44 0.65
45 0.73
46 0.81
47 0.82
48 0.83
49 0.86
50 0.84
51 0.81
52 0.84
53 0.84