Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369JYR4

Protein Details
Accession A0A369JYR4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
76-102STDTPGTEGKKRRRRRRSGSTGTATPPHydrophilic
NLS Segment(s)
PositionSequence
84-93GKKRRRRRRS
Subcellular Location(s) extr 16, plas 5, E.R. 2, mito 1, cyto 1, golg 1, vacu 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MYTSTTALLVLTAFIAPTLVVVAAPVYDPVTIGKPAATFICARDLAARSGDGFPATSEPRPMNIVPPSSQETPSLSTDTPGTEGKKRRRRRRSGSTGTATPPPEGQVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.03
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.06
17 0.08
18 0.09
19 0.09
20 0.09
21 0.08
22 0.1
23 0.1
24 0.1
25 0.08
26 0.09
27 0.13
28 0.12
29 0.12
30 0.14
31 0.15
32 0.15
33 0.15
34 0.14
35 0.11
36 0.12
37 0.12
38 0.09
39 0.08
40 0.07
41 0.09
42 0.1
43 0.09
44 0.11
45 0.11
46 0.12
47 0.14
48 0.14
49 0.16
50 0.17
51 0.19
52 0.18
53 0.21
54 0.25
55 0.24
56 0.25
57 0.22
58 0.21
59 0.23
60 0.23
61 0.23
62 0.18
63 0.17
64 0.16
65 0.16
66 0.17
67 0.16
68 0.18
69 0.22
70 0.31
71 0.41
72 0.51
73 0.61
74 0.7
75 0.78
76 0.86
77 0.89
78 0.92
79 0.92
80 0.92
81 0.91
82 0.87
83 0.81
84 0.74
85 0.69
86 0.6
87 0.5
88 0.4