FuNGI

A0A369JAC5

Protein Details

Accession

A0A369JAC5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
198-217	SKFVTKPSKKHKKSHQEVVQ	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 9, plas 8, extr 5, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR029069 HotDog_dom_sf

Amino Acid Sequences

MVLVPSSSRSTTMSLEKLVGALGPLLTSSLGSFFRLLPTVTKYLLFLVLLINVRSWPLAWHFRVFRPVFRVRIQHKLMKWRTMFKSPAGQIAAEEEWFDSISPIGADPFNYTVKYNSRASIDDSDFNGHLSNSSYAKTLDSARFKTAMAMFPMFFRAGGWMPLAATHYHFIREVPMLAQYEVRVSSGAWDHKWLYVVSKFVTKPSKKHKKSHQEVVQQTTPPADSSSTGDLFHASLRTPADEIYDSSTPSETPALVDTSAPAPDTAKALKAVAASLASEIEPDGATLHTISVSQCCYKIGRITVPPALVLAVNGFSVPQFTAADGSTPVVYSRANPPPHWAKAKAVMSRPHGGSTKALQALLKGGWRDVPEAERWWDVAMGGAVEERRRKGLDVVKSLGLGMGGARAL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.28
2	0.29
3	0.27
4	0.25
5	0.22
6	0.18
7	0.12
8	0.1
9	0.08
10	0.06
11	0.06
12	0.06
13	0.06
14	0.06
15	0.06
16	0.08
17	0.09
18	0.1
19	0.12
20	0.12
21	0.14
22	0.16
23	0.16
24	0.17
25	0.22
26	0.24
27	0.23
28	0.23
29	0.22
30	0.22
31	0.22
32	0.19
33	0.14
34	0.11
35	0.14
36	0.15
37	0.14
38	0.13
39	0.12
40	0.13
41	0.12
42	0.12
43	0.1
44	0.15
45	0.23
46	0.26
47	0.32
48	0.35
49	0.38
50	0.48
51	0.47
52	0.46
53	0.46
54	0.49
55	0.48
56	0.49
57	0.55
58	0.5
59	0.58
60	0.59
61	0.58
62	0.57
63	0.63
64	0.64
65	0.63
66	0.63
67	0.62
68	0.62
69	0.62
70	0.6
71	0.53
72	0.57
73	0.49
74	0.51
75	0.43
76	0.37
77	0.3
78	0.3
79	0.27
80	0.18
81	0.17
82	0.11
83	0.1
84	0.1
85	0.1
86	0.06
87	0.05
88	0.06
89	0.05
90	0.06
91	0.06
92	0.07
93	0.07
94	0.09
95	0.11
96	0.12
97	0.13
98	0.14
99	0.16
100	0.2
101	0.24
102	0.24
103	0.24
104	0.25
105	0.25
106	0.29
107	0.32
108	0.3
109	0.29
110	0.28
111	0.28
112	0.26
113	0.25
114	0.21
115	0.14
116	0.12
117	0.12
118	0.13
119	0.11
120	0.12
121	0.12
122	0.12
123	0.13
124	0.14
125	0.16
126	0.2
127	0.25
128	0.27
129	0.28
130	0.28
131	0.28
132	0.3
133	0.28
134	0.24
135	0.22
136	0.21
137	0.19
138	0.18
139	0.2
140	0.16
141	0.13
142	0.1
143	0.1
144	0.09
145	0.09
146	0.09
147	0.08
148	0.08
149	0.08
150	0.09
151	0.08
152	0.08
153	0.09
154	0.09
155	0.1
156	0.1
157	0.09
158	0.1
159	0.11
160	0.1
161	0.09
162	0.11
163	0.11
164	0.12
165	0.12
166	0.1
167	0.1
168	0.1
169	0.1
170	0.07
171	0.06
172	0.07
173	0.11
174	0.12
175	0.12
176	0.14
177	0.14
178	0.15
179	0.16
180	0.14
181	0.14
182	0.13
183	0.14
184	0.13
185	0.17
186	0.17
187	0.2
188	0.29
189	0.28
190	0.34
191	0.44
192	0.54
193	0.56
194	0.64
195	0.7
196	0.73
197	0.78
198	0.82
199	0.8
200	0.78
201	0.75
202	0.73
203	0.66
204	0.55
205	0.48
206	0.38
207	0.29
208	0.2
209	0.16
210	0.11
211	0.08
212	0.1
213	0.13
214	0.12
215	0.12
216	0.12
217	0.12
218	0.12
219	0.11
220	0.1
221	0.07
222	0.08
223	0.08
224	0.09
225	0.09
226	0.09
227	0.1
228	0.1
229	0.1
230	0.13
231	0.13
232	0.13
233	0.13
234	0.13
235	0.11
236	0.11
237	0.11
238	0.07
239	0.07
240	0.08
241	0.09
242	0.09
243	0.09
244	0.08
245	0.09
246	0.09
247	0.09
248	0.08
249	0.07
250	0.08
251	0.1
252	0.1
253	0.1
254	0.1
255	0.1
256	0.12
257	0.11
258	0.11
259	0.09
260	0.09
261	0.08
262	0.07
263	0.08
264	0.06
265	0.06
266	0.05
267	0.05
268	0.05
269	0.05
270	0.05
271	0.05
272	0.05
273	0.05
274	0.05
275	0.05
276	0.06
277	0.06
278	0.08
279	0.1
280	0.11
281	0.11
282	0.13
283	0.14
284	0.16
285	0.2
286	0.21
287	0.25
288	0.27
289	0.31
290	0.33
291	0.32
292	0.29
293	0.25
294	0.22
295	0.16
296	0.13
297	0.09
298	0.06
299	0.06
300	0.06
301	0.06
302	0.05
303	0.06
304	0.06
305	0.07
306	0.06
307	0.07
308	0.09
309	0.09
310	0.1
311	0.09
312	0.1
313	0.09
314	0.09
315	0.09
316	0.09
317	0.09
318	0.1
319	0.18
320	0.25
321	0.29
322	0.29
323	0.37
324	0.44
325	0.51
326	0.55
327	0.49
328	0.46
329	0.51
330	0.58
331	0.57
332	0.55
333	0.55
334	0.55
335	0.59
336	0.56
337	0.51
338	0.46
339	0.41
340	0.39
341	0.35
342	0.37
343	0.32
344	0.32
345	0.27
346	0.26
347	0.27
348	0.25
349	0.25
350	0.18
351	0.17
352	0.2
353	0.21
354	0.22
355	0.22
356	0.23
357	0.23
358	0.26
359	0.29
360	0.27
361	0.26
362	0.25
363	0.22
364	0.19
365	0.17
366	0.14
367	0.1
368	0.09
369	0.11
370	0.11
371	0.16
372	0.21
373	0.21
374	0.25
375	0.26
376	0.28
377	0.34
378	0.41
379	0.45
380	0.48
381	0.5
382	0.48
383	0.47
384	0.45
385	0.37
386	0.28
387	0.19
388	0.11

A0A369JAC5

3D AlphaFold-predicted Structure Viewer