Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369J5T8

Protein Details
Accession A0A369J5T8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
148-177LFAQEEQRRRRSRHDRPRTRERDRDKDKVGBasic
NLS Segment(s)
PositionSequence
155-176RRRRSRHDRPRTRERDRDKDKV
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000555  JAMM/MPN+_dom  
IPR037518  MPN  
IPR044098  STAMBP/STALP-like_MPN  
IPR015063  USP8_dimer  
Gene Ontology GO:0061578  F:K63-linked deubiquitinase activity  
GO:0140492  F:metal-dependent deubiquitinase activity  
GO:0070536  P:protein K63-linked deubiquitination  
Pfam View protein in Pfam  
PF01398  JAB  
PF08969  USP8_dimer  
PROSITE View protein in PROSITE  
PS50249  MPN  
CDD cd08066  MPN_AMSH_like  
Amino Acid Sequences MNSPYSSSSRPNPQTRPAMIAELAEAALENLWDEKLELKHYLRTAERCRSHAKHFINEDDYENAFIEYARAATLVLEKLSSHRDYHTLLNAAQRHNLALNGQDILDKLGELKPMLVDRYEKWSKQHPDPTNPNILPDFRRRRLRSEELFAQEEQRRRRSRHDRPRTRERDRDKDKVGLEREREKQSAVEEQLAEELRLYKEQREAVQRQQAADDRERERDRAASRAAVAAADRKREVAVAAARSAATQPPGAVPDLTFSRTPVQNNAYNGTPLPQDSRRPDEEHFRHQQQQEEMRHREEEIVRKREQKKWEQEGFARRQQESDEAARAVRQTIASNNMGVATAMTPSSLASTPSVTYSTSASSSNVSTPATSFYENMTPTQSTSGLRPPPAVKSRPPSFLSAQFEHVPPIMPLESPTRYEDDSTDSESVHNGRRSSGKQKQAMDYSNRTPSRAPARSPSYPPPITTTSPPPADTRIQYPQLMSQHQKHQGYYPSLNSMFGPATADSFRYATAAPGSNFKDMYPSYLLPRPSAPYGTPQPSPTPQAHPIQYPSYPGPSRPAPPVPSTTPPSSARASIDRTMGVPKSEPSPALRTVTLPRGCLPRFLTLAKANTDMNMETCGLLLGRDRGGKFLVTTLLIPKQHSTSDTCTMDEEELVMQFTEERDLITLGWIHTHPSQSCFMSSVDLHTHSGFQCMLPESFAVVCAPKSNPNFGIFRLTDPPGLKTVLECTAKEAFHPHPDLPIYTDADKGHVQMKEIPLEIVDLRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.69
3 0.67
4 0.59
5 0.54
6 0.46
7 0.4
8 0.31
9 0.23
10 0.2
11 0.14
12 0.11
13 0.07
14 0.07
15 0.06
16 0.06
17 0.05
18 0.06
19 0.06
20 0.07
21 0.11
22 0.14
23 0.17
24 0.23
25 0.25
26 0.31
27 0.33
28 0.39
29 0.4
30 0.47
31 0.53
32 0.57
33 0.6
34 0.58
35 0.66
36 0.65
37 0.66
38 0.67
39 0.64
40 0.63
41 0.63
42 0.65
43 0.61
44 0.57
45 0.52
46 0.46
47 0.41
48 0.33
49 0.28
50 0.21
51 0.16
52 0.14
53 0.12
54 0.09
55 0.08
56 0.07
57 0.06
58 0.06
59 0.07
60 0.11
61 0.12
62 0.11
63 0.11
64 0.12
65 0.15
66 0.2
67 0.22
68 0.2
69 0.21
70 0.24
71 0.26
72 0.31
73 0.34
74 0.31
75 0.31
76 0.36
77 0.39
78 0.38
79 0.38
80 0.34
81 0.3
82 0.27
83 0.27
84 0.2
85 0.17
86 0.17
87 0.14
88 0.14
89 0.13
90 0.12
91 0.13
92 0.12
93 0.1
94 0.1
95 0.11
96 0.13
97 0.12
98 0.13
99 0.13
100 0.16
101 0.17
102 0.17
103 0.18
104 0.18
105 0.27
106 0.33
107 0.32
108 0.34
109 0.43
110 0.48
111 0.55
112 0.63
113 0.62
114 0.66
115 0.73
116 0.75
117 0.75
118 0.68
119 0.61
120 0.54
121 0.5
122 0.45
123 0.47
124 0.51
125 0.48
126 0.59
127 0.59
128 0.63
129 0.69
130 0.73
131 0.69
132 0.68
133 0.68
134 0.62
135 0.62
136 0.55
137 0.53
138 0.49
139 0.49
140 0.47
141 0.49
142 0.51
143 0.52
144 0.62
145 0.67
146 0.73
147 0.78
148 0.82
149 0.84
150 0.86
151 0.93
152 0.92
153 0.91
154 0.89
155 0.87
156 0.87
157 0.84
158 0.84
159 0.77
160 0.73
161 0.67
162 0.66
163 0.63
164 0.59
165 0.56
166 0.55
167 0.57
168 0.56
169 0.54
170 0.46
171 0.41
172 0.37
173 0.39
174 0.33
175 0.3
176 0.25
177 0.24
178 0.26
179 0.25
180 0.22
181 0.15
182 0.15
183 0.12
184 0.16
185 0.17
186 0.16
187 0.2
188 0.24
189 0.28
190 0.34
191 0.38
192 0.42
193 0.49
194 0.48
195 0.44
196 0.45
197 0.44
198 0.4
199 0.41
200 0.4
201 0.35
202 0.42
203 0.43
204 0.4
205 0.38
206 0.39
207 0.36
208 0.34
209 0.33
210 0.27
211 0.26
212 0.26
213 0.24
214 0.18
215 0.17
216 0.19
217 0.19
218 0.19
219 0.19
220 0.18
221 0.18
222 0.18
223 0.18
224 0.16
225 0.18
226 0.17
227 0.17
228 0.17
229 0.17
230 0.17
231 0.17
232 0.13
233 0.1
234 0.09
235 0.08
236 0.09
237 0.1
238 0.11
239 0.1
240 0.09
241 0.1
242 0.12
243 0.14
244 0.13
245 0.13
246 0.17
247 0.19
248 0.21
249 0.23
250 0.26
251 0.28
252 0.3
253 0.31
254 0.27
255 0.25
256 0.23
257 0.2
258 0.16
259 0.12
260 0.15
261 0.16
262 0.22
263 0.25
264 0.31
265 0.33
266 0.36
267 0.38
268 0.44
269 0.46
270 0.48
271 0.5
272 0.49
273 0.53
274 0.51
275 0.54
276 0.49
277 0.53
278 0.52
279 0.54
280 0.52
281 0.48
282 0.46
283 0.41
284 0.4
285 0.36
286 0.38
287 0.38
288 0.41
289 0.42
290 0.5
291 0.55
292 0.57
293 0.61
294 0.61
295 0.62
296 0.66
297 0.69
298 0.64
299 0.65
300 0.68
301 0.66
302 0.61
303 0.55
304 0.45
305 0.4
306 0.36
307 0.34
308 0.28
309 0.24
310 0.21
311 0.18
312 0.18
313 0.18
314 0.17
315 0.14
316 0.11
317 0.1
318 0.09
319 0.1
320 0.14
321 0.14
322 0.14
323 0.13
324 0.12
325 0.11
326 0.1
327 0.09
328 0.04
329 0.04
330 0.04
331 0.04
332 0.04
333 0.04
334 0.06
335 0.06
336 0.06
337 0.06
338 0.07
339 0.08
340 0.09
341 0.09
342 0.08
343 0.08
344 0.08
345 0.09
346 0.09
347 0.09
348 0.09
349 0.1
350 0.1
351 0.1
352 0.1
353 0.09
354 0.08
355 0.08
356 0.1
357 0.11
358 0.11
359 0.11
360 0.11
361 0.14
362 0.14
363 0.15
364 0.14
365 0.12
366 0.12
367 0.13
368 0.12
369 0.1
370 0.11
371 0.16
372 0.17
373 0.17
374 0.19
375 0.19
376 0.24
377 0.29
378 0.3
379 0.29
380 0.34
381 0.37
382 0.41
383 0.42
384 0.4
385 0.37
386 0.4
387 0.41
388 0.35
389 0.34
390 0.3
391 0.28
392 0.25
393 0.23
394 0.17
395 0.11
396 0.11
397 0.09
398 0.07
399 0.09
400 0.12
401 0.13
402 0.14
403 0.16
404 0.16
405 0.16
406 0.17
407 0.16
408 0.16
409 0.17
410 0.18
411 0.17
412 0.15
413 0.15
414 0.15
415 0.17
416 0.18
417 0.19
418 0.16
419 0.17
420 0.22
421 0.25
422 0.34
423 0.4
424 0.43
425 0.46
426 0.49
427 0.52
428 0.53
429 0.54
430 0.5
431 0.47
432 0.43
433 0.46
434 0.43
435 0.4
436 0.35
437 0.36
438 0.4
439 0.38
440 0.36
441 0.35
442 0.41
443 0.44
444 0.49
445 0.49
446 0.48
447 0.45
448 0.43
449 0.41
450 0.38
451 0.36
452 0.34
453 0.34
454 0.31
455 0.31
456 0.32
457 0.28
458 0.28
459 0.29
460 0.27
461 0.26
462 0.27
463 0.28
464 0.28
465 0.27
466 0.28
467 0.29
468 0.32
469 0.31
470 0.3
471 0.35
472 0.42
473 0.43
474 0.39
475 0.39
476 0.41
477 0.43
478 0.4
479 0.34
480 0.32
481 0.31
482 0.31
483 0.26
484 0.22
485 0.16
486 0.14
487 0.14
488 0.09
489 0.1
490 0.1
491 0.11
492 0.1
493 0.1
494 0.1
495 0.09
496 0.09
497 0.08
498 0.11
499 0.14
500 0.13
501 0.18
502 0.2
503 0.21
504 0.21
505 0.2
506 0.22
507 0.19
508 0.22
509 0.2
510 0.19
511 0.21
512 0.25
513 0.26
514 0.23
515 0.25
516 0.24
517 0.22
518 0.23
519 0.2
520 0.22
521 0.28
522 0.31
523 0.31
524 0.3
525 0.32
526 0.33
527 0.36
528 0.33
529 0.32
530 0.33
531 0.37
532 0.37
533 0.35
534 0.36
535 0.36
536 0.33
537 0.31
538 0.28
539 0.3
540 0.28
541 0.27
542 0.28
543 0.28
544 0.31
545 0.32
546 0.36
547 0.33
548 0.35
549 0.39
550 0.39
551 0.41
552 0.43
553 0.4
554 0.4
555 0.38
556 0.39
557 0.36
558 0.33
559 0.3
560 0.29
561 0.32
562 0.29
563 0.28
564 0.25
565 0.24
566 0.26
567 0.25
568 0.22
569 0.18
570 0.17
571 0.18
572 0.2
573 0.2
574 0.2
575 0.23
576 0.25
577 0.26
578 0.26
579 0.25
580 0.28
581 0.36
582 0.34
583 0.31
584 0.31
585 0.36
586 0.36
587 0.39
588 0.37
589 0.33
590 0.34
591 0.33
592 0.35
593 0.33
594 0.36
595 0.33
596 0.32
597 0.27
598 0.25
599 0.26
600 0.21
601 0.16
602 0.15
603 0.13
604 0.11
605 0.11
606 0.1
607 0.08
608 0.08
609 0.09
610 0.09
611 0.11
612 0.16
613 0.16
614 0.18
615 0.19
616 0.19
617 0.18
618 0.17
619 0.17
620 0.13
621 0.14
622 0.17
623 0.21
624 0.22
625 0.23
626 0.23
627 0.24
628 0.25
629 0.26
630 0.27
631 0.27
632 0.34
633 0.34
634 0.32
635 0.31
636 0.31
637 0.29
638 0.24
639 0.19
640 0.12
641 0.11
642 0.11
643 0.09
644 0.08
645 0.08
646 0.08
647 0.09
648 0.08
649 0.08
650 0.09
651 0.1
652 0.1
653 0.11
654 0.12
655 0.1
656 0.13
657 0.13
658 0.15
659 0.17
660 0.23
661 0.22
662 0.24
663 0.28
664 0.26
665 0.27
666 0.26
667 0.24
668 0.22
669 0.21
670 0.22
671 0.22
672 0.23
673 0.23
674 0.22
675 0.25
676 0.22
677 0.24
678 0.2
679 0.16
680 0.18
681 0.19
682 0.19
683 0.16
684 0.16
685 0.15
686 0.15
687 0.15
688 0.13
689 0.11
690 0.11
691 0.14
692 0.16
693 0.22
694 0.25
695 0.31
696 0.32
697 0.36
698 0.37
699 0.35
700 0.42
701 0.35
702 0.36
703 0.35
704 0.35
705 0.36
706 0.35
707 0.36
708 0.3
709 0.3
710 0.26
711 0.22
712 0.24
713 0.26
714 0.28
715 0.26
716 0.28
717 0.32
718 0.32
719 0.31
720 0.33
721 0.29
722 0.34
723 0.38
724 0.34
725 0.34
726 0.37
727 0.37
728 0.35
729 0.35
730 0.31
731 0.29
732 0.32
733 0.26
734 0.28
735 0.27
736 0.25
737 0.28
738 0.25
739 0.26
740 0.28
741 0.32
742 0.33
743 0.33
744 0.32
745 0.25
746 0.27
747 0.26