Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369JUY3

Protein Details
Accession A0A369JUY3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-65AFYDKWNKGKQWKDIRHKYITEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 6, E.R. 6, mito 5, golg 5, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MALMFMQLAATVYNTFFKRNSVYVTAIFASAFAFGVGFDVGVTAFYDKWNKGKQWKDIRHKYITEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.17
5 0.19
6 0.2
7 0.23
8 0.22
9 0.24
10 0.22
11 0.24
12 0.22
13 0.19
14 0.17
15 0.13
16 0.09
17 0.07
18 0.06
19 0.04
20 0.03
21 0.03
22 0.04
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.06
33 0.1
34 0.11
35 0.18
36 0.23
37 0.28
38 0.36
39 0.44
40 0.52
41 0.6
42 0.7
43 0.75
44 0.8
45 0.83
46 0.82
47 0.76