Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369K786

Protein Details
Accession A0A369K786   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPRGSKGTSKKKAPATRKSTRKGPAKKSGEBasic
NLS Segment(s)
PositionSequence
4-27GSKGTSKKKAPATRKSTRKGPAKK
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MPRGSKGTSKKKAPATRKSTRKGPAKKSGEDEEEVDNDIEENAEEECVDGGRNDDDPDDNDNDNEEGDGLESHHRIELDKELEVKTDTVKDLLLMFSDKTTVTFKTGDVFEKVTGRWCLSCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.81
4 0.83
5 0.83
6 0.81
7 0.8
8 0.81
9 0.8
10 0.8
11 0.81
12 0.78
13 0.76
14 0.73
15 0.7
16 0.63
17 0.55
18 0.48
19 0.39
20 0.33
21 0.3
22 0.23
23 0.17
24 0.13
25 0.11
26 0.09
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.07
42 0.07
43 0.09
44 0.12
45 0.13
46 0.13
47 0.12
48 0.12
49 0.12
50 0.11
51 0.1
52 0.07
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.06
59 0.07
60 0.08
61 0.08
62 0.08
63 0.1
64 0.14
65 0.14
66 0.15
67 0.17
68 0.16
69 0.17
70 0.17
71 0.16
72 0.13
73 0.13
74 0.13
75 0.11
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.09
84 0.1
85 0.09
86 0.1
87 0.12
88 0.13
89 0.14
90 0.15
91 0.15
92 0.19
93 0.21
94 0.22
95 0.22
96 0.23
97 0.23
98 0.24
99 0.25
100 0.26
101 0.28
102 0.28