Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369KAW0

Protein Details
Accession A0A369KAW0   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-37EETMQGTPNRSRKRQKRSRIEALDARQHydrophilic
NLS Segment(s)
PositionSequence
22-27RKRQKR
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005100  NGN-domain  
IPR036735  NGN_dom_sf  
IPR039659  SPT5  
Gene Ontology GO:0032784  P:regulation of DNA-templated transcription elongation  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF03439  Spt5-NGN  
Amino Acid Sequences MNPQTEVSHYEETMQGTPNRSRKRQKRSRIEALDARQFLSLEAEVDDDDQNGVDEEDGEFDDFIDELEPIAADRGVSHHLLLLENARVNDESEWESLLARARSRGRNTIEAHQTNEMHPPIPTDVNICLWRVSVKPGLEETTAFLLMEKIIRGGEGCWGVKTVIGRVSRPGWIVIEASTIRDVQMLCHGVSNIFWQKIHVVEPEDAPSCLKEAESYTPPKQSWVRLTRHPHKGDLAYIRELNEKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.27
4 0.35
5 0.42
6 0.49
7 0.55
8 0.64
9 0.7
10 0.78
11 0.84
12 0.87
13 0.89
14 0.9
15 0.92
16 0.89
17 0.87
18 0.84
19 0.8
20 0.77
21 0.67
22 0.58
23 0.47
24 0.4
25 0.31
26 0.26
27 0.19
28 0.11
29 0.11
30 0.1
31 0.09
32 0.11
33 0.11
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.04
60 0.04
61 0.06
62 0.08
63 0.09
64 0.09
65 0.09
66 0.1
67 0.11
68 0.11
69 0.11
70 0.11
71 0.12
72 0.12
73 0.11
74 0.11
75 0.11
76 0.11
77 0.11
78 0.12
79 0.1
80 0.11
81 0.1
82 0.1
83 0.1
84 0.13
85 0.12
86 0.11
87 0.15
88 0.2
89 0.26
90 0.29
91 0.35
92 0.35
93 0.41
94 0.43
95 0.46
96 0.49
97 0.44
98 0.43
99 0.39
100 0.36
101 0.3
102 0.31
103 0.24
104 0.16
105 0.15
106 0.14
107 0.13
108 0.12
109 0.12
110 0.09
111 0.1
112 0.12
113 0.13
114 0.12
115 0.11
116 0.1
117 0.11
118 0.1
119 0.13
120 0.14
121 0.13
122 0.14
123 0.15
124 0.17
125 0.16
126 0.16
127 0.14
128 0.12
129 0.11
130 0.1
131 0.09
132 0.07
133 0.07
134 0.08
135 0.06
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.08
142 0.1
143 0.11
144 0.1
145 0.11
146 0.11
147 0.12
148 0.12
149 0.11
150 0.14
151 0.16
152 0.16
153 0.18
154 0.2
155 0.21
156 0.21
157 0.2
158 0.15
159 0.15
160 0.15
161 0.12
162 0.14
163 0.12
164 0.12
165 0.12
166 0.12
167 0.1
168 0.12
169 0.11
170 0.09
171 0.15
172 0.16
173 0.15
174 0.16
175 0.16
176 0.15
177 0.15
178 0.21
179 0.2
180 0.19
181 0.19
182 0.19
183 0.2
184 0.22
185 0.24
186 0.2
187 0.18
188 0.19
189 0.2
190 0.23
191 0.23
192 0.22
193 0.2
194 0.18
195 0.15
196 0.14
197 0.13
198 0.1
199 0.12
200 0.18
201 0.23
202 0.3
203 0.32
204 0.38
205 0.38
206 0.43
207 0.44
208 0.45
209 0.49
210 0.51
211 0.54
212 0.57
213 0.68
214 0.71
215 0.78
216 0.74
217 0.68
218 0.66
219 0.63
220 0.61
221 0.59
222 0.54
223 0.49
224 0.47
225 0.45