Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369JP72

Protein Details
Accession A0A369JP72    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
65-89PLTTTESKVPKRRRINKLVPPRPFPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 4, mito 3, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSSSASKKRKLDSATRDSNKRLKLTAASGSSRVVKVTTSTTEDPAAGDNTLTEVHDKNLDGVMEPLTTTESKVPKRRRINKLVPPRPFPTVPTSVSATGPRSAHNEGKNLICITRKTSLGAYMRRCKDVIIKDGYKTLYLSAMGAAIPLLLSLTMALPPILPFSADEIHTEVTTGTVEVQDEVIPDDEDEDITYQTRGKSTLKVVIKIGDGEYEGGLSGSAKKNGKNRGGNNGARPDKGVLGQRGSESGDKGKAVQRGSHDVILQEPEQEDMEML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.76
4 0.75
5 0.75
6 0.71
7 0.65
8 0.57
9 0.5
10 0.47
11 0.46
12 0.47
13 0.44
14 0.4
15 0.38
16 0.38
17 0.38
18 0.33
19 0.29
20 0.22
21 0.17
22 0.16
23 0.19
24 0.2
25 0.23
26 0.25
27 0.26
28 0.27
29 0.26
30 0.24
31 0.22
32 0.2
33 0.14
34 0.11
35 0.09
36 0.09
37 0.1
38 0.1
39 0.1
40 0.09
41 0.11
42 0.13
43 0.13
44 0.13
45 0.15
46 0.14
47 0.13
48 0.13
49 0.13
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.1
56 0.14
57 0.2
58 0.27
59 0.36
60 0.45
61 0.53
62 0.64
63 0.73
64 0.78
65 0.82
66 0.85
67 0.86
68 0.89
69 0.88
70 0.84
71 0.79
72 0.72
73 0.67
74 0.57
75 0.5
76 0.45
77 0.4
78 0.35
79 0.32
80 0.32
81 0.27
82 0.28
83 0.27
84 0.23
85 0.21
86 0.2
87 0.19
88 0.2
89 0.23
90 0.27
91 0.27
92 0.28
93 0.26
94 0.27
95 0.28
96 0.24
97 0.22
98 0.19
99 0.17
100 0.18
101 0.19
102 0.19
103 0.18
104 0.18
105 0.23
106 0.25
107 0.31
108 0.34
109 0.39
110 0.4
111 0.4
112 0.4
113 0.35
114 0.36
115 0.34
116 0.33
117 0.32
118 0.31
119 0.3
120 0.33
121 0.33
122 0.27
123 0.22
124 0.17
125 0.11
126 0.09
127 0.09
128 0.06
129 0.06
130 0.05
131 0.05
132 0.04
133 0.03
134 0.03
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.05
147 0.04
148 0.04
149 0.05
150 0.07
151 0.09
152 0.09
153 0.1
154 0.11
155 0.12
156 0.11
157 0.11
158 0.09
159 0.07
160 0.07
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.05
168 0.06
169 0.06
170 0.07
171 0.07
172 0.06
173 0.07
174 0.06
175 0.06
176 0.07
177 0.06
178 0.06
179 0.07
180 0.07
181 0.08
182 0.09
183 0.1
184 0.12
185 0.13
186 0.17
187 0.2
188 0.28
189 0.3
190 0.32
191 0.32
192 0.32
193 0.31
194 0.28
195 0.25
196 0.17
197 0.14
198 0.13
199 0.11
200 0.09
201 0.08
202 0.06
203 0.06
204 0.05
205 0.1
206 0.12
207 0.18
208 0.2
209 0.25
210 0.32
211 0.41
212 0.5
213 0.54
214 0.56
215 0.6
216 0.67
217 0.68
218 0.68
219 0.69
220 0.63
221 0.55
222 0.52
223 0.44
224 0.37
225 0.36
226 0.36
227 0.3
228 0.3
229 0.31
230 0.3
231 0.3
232 0.31
233 0.29
234 0.24
235 0.24
236 0.24
237 0.22
238 0.25
239 0.28
240 0.31
241 0.31
242 0.33
243 0.34
244 0.39
245 0.43
246 0.43
247 0.39
248 0.35
249 0.35
250 0.35
251 0.3
252 0.23
253 0.19
254 0.18
255 0.17