Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369JTB2

Protein Details
Accession A0A369JTB2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
214-233GTVRKSKSLRSAPAKRKREEBasic
NLS Segment(s)
PositionSequence
218-231KSKSLRSAPAKRKR
272-280RRVKRARRS
Subcellular Location(s) cyto 13.5, cyto_nucl 8, extr 7, mito 4
Family & Domain DBs
Amino Acid Sequences MDARSDPRNPLPYWSVASLGSKAVIIQIRTPAGSRGSPVTVAQPTQLVEPTRHHTAAGLSTTHGGAEATANSPAPHPAGLPIASPGTDLMDDTPSTLPTAPPPPHAPPTPGIILVLSYTSTSTPTPPHLIPISIPTTPQTPEHPVAPTRIPPPAPLIYIPIPFSPCPAPIYLLPICGASDTAVLEGVAAAEAGWKVRAAEGGWHGSAPAHVVVGTVRKSKSLRSAPAKRKREEDGEGEGEGKGEGEGKGEGDEGYGGVFKLLHSYVCGMGGRRVKRARRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.34
3 0.29
4 0.3
5 0.25
6 0.22
7 0.18
8 0.14
9 0.13
10 0.16
11 0.17
12 0.16
13 0.17
14 0.21
15 0.22
16 0.23
17 0.24
18 0.22
19 0.22
20 0.21
21 0.21
22 0.2
23 0.2
24 0.21
25 0.21
26 0.23
27 0.22
28 0.22
29 0.21
30 0.19
31 0.18
32 0.18
33 0.21
34 0.18
35 0.18
36 0.22
37 0.27
38 0.3
39 0.3
40 0.28
41 0.25
42 0.26
43 0.27
44 0.25
45 0.2
46 0.15
47 0.16
48 0.16
49 0.15
50 0.13
51 0.08
52 0.06
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.09
63 0.08
64 0.09
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.1
71 0.1
72 0.09
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.08
79 0.09
80 0.1
81 0.09
82 0.1
83 0.1
84 0.09
85 0.11
86 0.18
87 0.17
88 0.2
89 0.24
90 0.27
91 0.31
92 0.32
93 0.32
94 0.26
95 0.29
96 0.27
97 0.22
98 0.19
99 0.14
100 0.13
101 0.1
102 0.09
103 0.05
104 0.04
105 0.05
106 0.05
107 0.06
108 0.06
109 0.08
110 0.09
111 0.11
112 0.14
113 0.14
114 0.17
115 0.16
116 0.16
117 0.15
118 0.17
119 0.18
120 0.14
121 0.14
122 0.12
123 0.13
124 0.14
125 0.15
126 0.14
127 0.16
128 0.17
129 0.18
130 0.19
131 0.18
132 0.2
133 0.2
134 0.2
135 0.17
136 0.19
137 0.18
138 0.17
139 0.2
140 0.19
141 0.19
142 0.16
143 0.18
144 0.17
145 0.18
146 0.19
147 0.15
148 0.16
149 0.15
150 0.16
151 0.14
152 0.13
153 0.13
154 0.13
155 0.14
156 0.12
157 0.18
158 0.16
159 0.15
160 0.15
161 0.14
162 0.13
163 0.11
164 0.11
165 0.06
166 0.06
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.04
173 0.04
174 0.03
175 0.03
176 0.02
177 0.03
178 0.03
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.07
185 0.06
186 0.1
187 0.13
188 0.16
189 0.16
190 0.16
191 0.15
192 0.14
193 0.14
194 0.12
195 0.09
196 0.06
197 0.06
198 0.06
199 0.07
200 0.11
201 0.14
202 0.17
203 0.17
204 0.21
205 0.23
206 0.26
207 0.35
208 0.39
209 0.45
210 0.51
211 0.62
212 0.68
213 0.78
214 0.83
215 0.77
216 0.74
217 0.71
218 0.68
219 0.62
220 0.57
221 0.53
222 0.47
223 0.44
224 0.4
225 0.34
226 0.27
227 0.21
228 0.16
229 0.09
230 0.08
231 0.07
232 0.08
233 0.08
234 0.08
235 0.09
236 0.09
237 0.09
238 0.08
239 0.08
240 0.06
241 0.07
242 0.07
243 0.06
244 0.06
245 0.06
246 0.06
247 0.09
248 0.1
249 0.1
250 0.11
251 0.13
252 0.14
253 0.17
254 0.18
255 0.16
256 0.23
257 0.3
258 0.32
259 0.4
260 0.48