Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369J0X9

Protein Details
Accession A0A369J0X9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-65DSFNSLRRPWHKRRAKGKLKSNPSPSWHydrophilic
NLS Segment(s)
PositionSequence
45-58RRPWHKRRAKGKLK
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MRSIPRIDIAPGAPVSLRDPSSKKHQCSNAAVHEILVSDSFNSLRRPWHKRRAKGKLKSNPSPSWILQHAARFIPQPPQPPILRGTYHQYARHPAINPASQLIPIFHRIRCPYAEPLYNPTDDPASAAKDVFLHINIRSGRLGDST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.19
5 0.2
6 0.22
7 0.26
8 0.37
9 0.45
10 0.46
11 0.51
12 0.56
13 0.58
14 0.62
15 0.66
16 0.61
17 0.57
18 0.53
19 0.45
20 0.38
21 0.31
22 0.24
23 0.17
24 0.1
25 0.06
26 0.07
27 0.07
28 0.09
29 0.1
30 0.11
31 0.19
32 0.27
33 0.36
34 0.44
35 0.54
36 0.61
37 0.69
38 0.79
39 0.83
40 0.85
41 0.86
42 0.87
43 0.86
44 0.86
45 0.84
46 0.81
47 0.72
48 0.65
49 0.6
50 0.49
51 0.44
52 0.36
53 0.3
54 0.24
55 0.23
56 0.22
57 0.17
58 0.18
59 0.14
60 0.14
61 0.18
62 0.18
63 0.21
64 0.22
65 0.26
66 0.26
67 0.27
68 0.28
69 0.26
70 0.24
71 0.21
72 0.25
73 0.26
74 0.3
75 0.31
76 0.3
77 0.32
78 0.34
79 0.37
80 0.32
81 0.3
82 0.31
83 0.3
84 0.29
85 0.25
86 0.23
87 0.19
88 0.18
89 0.16
90 0.13
91 0.17
92 0.19
93 0.18
94 0.23
95 0.25
96 0.28
97 0.3
98 0.32
99 0.32
100 0.35
101 0.39
102 0.36
103 0.39
104 0.39
105 0.37
106 0.33
107 0.28
108 0.24
109 0.19
110 0.19
111 0.16
112 0.16
113 0.16
114 0.16
115 0.15
116 0.14
117 0.15
118 0.15
119 0.14
120 0.13
121 0.13
122 0.2
123 0.21
124 0.22
125 0.22
126 0.22