Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369J7V6

Protein Details
Accession A0A369J7V6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-96IELRRTVQKFSRKKTRARKVPNVRSFHHydrophilic
NLS Segment(s)
PositionSequence
80-88SRKKTRARK
Subcellular Location(s) nucl 22, cyto_nucl 15, cyto 4
Family & Domain DBs
Amino Acid Sequences MLSNNIFVDIQSSVNALVEEHLNTTVPFSQQQEAKLNTVHSIVSLGTRFEQFPQLAAFQAEWVTTELIKIELRRTVQKFSRKKTRARKVPNVRSFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.07
5 0.08
6 0.08
7 0.09
8 0.09
9 0.09
10 0.09
11 0.1
12 0.11
13 0.11
14 0.12
15 0.14
16 0.17
17 0.19
18 0.22
19 0.26
20 0.27
21 0.27
22 0.26
23 0.24
24 0.21
25 0.2
26 0.16
27 0.1
28 0.09
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.08
35 0.08
36 0.08
37 0.12
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.1
45 0.07
46 0.08
47 0.07
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.1
56 0.1
57 0.11
58 0.14
59 0.17
60 0.26
61 0.29
62 0.35
63 0.41
64 0.5
65 0.57
66 0.63
67 0.72
68 0.7
69 0.77
70 0.81
71 0.84
72 0.85
73 0.87
74 0.89
75 0.89
76 0.93