Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IPD1

Protein Details
Accession A0A139IPD1    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-45EQALNAGSKKKERKRRRTQYYQVEAAVHydrophilic
119-148DEVVTCRDSRKCKKRKEKLKRLRAQRDVLRBasic
NLS Segment(s)
PositionSequence
26-35SKKKERKRRR
129-142KCKKRKEKLKRLRA
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MQTQLQEEVDTYRMIDFSEQALNAGSKKKERKRRRTQYYQVEAAVSRERETRERLNKAQRERETLKSQRRDQQTEILMLEARKFEDDKTISELRKELQAARRGFVESRREQQQQTAASDEVVTCRDSRKCKKRKEKLKRLRAQRDVLRDELDGVRKERVMELEKVVDREEPYLIGVFRLMRKQVDDLRKENDRLVEMSAALISVRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.11
5 0.15
6 0.14
7 0.14
8 0.15
9 0.16
10 0.17
11 0.22
12 0.23
13 0.28
14 0.38
15 0.47
16 0.57
17 0.67
18 0.76
19 0.82
20 0.9
21 0.92
22 0.93
23 0.94
24 0.94
25 0.91
26 0.84
27 0.74
28 0.64
29 0.54
30 0.46
31 0.4
32 0.3
33 0.23
34 0.22
35 0.24
36 0.25
37 0.3
38 0.37
39 0.41
40 0.48
41 0.54
42 0.61
43 0.66
44 0.7
45 0.75
46 0.69
47 0.68
48 0.65
49 0.65
50 0.64
51 0.65
52 0.67
53 0.65
54 0.68
55 0.67
56 0.7
57 0.68
58 0.61
59 0.6
60 0.52
61 0.46
62 0.4
63 0.33
64 0.27
65 0.22
66 0.2
67 0.13
68 0.11
69 0.09
70 0.1
71 0.09
72 0.14
73 0.15
74 0.16
75 0.21
76 0.25
77 0.24
78 0.25
79 0.25
80 0.19
81 0.21
82 0.21
83 0.19
84 0.21
85 0.29
86 0.28
87 0.28
88 0.29
89 0.27
90 0.27
91 0.27
92 0.28
93 0.23
94 0.27
95 0.32
96 0.34
97 0.33
98 0.35
99 0.35
100 0.3
101 0.28
102 0.26
103 0.21
104 0.18
105 0.18
106 0.15
107 0.11
108 0.1
109 0.09
110 0.07
111 0.1
112 0.15
113 0.23
114 0.34
115 0.44
116 0.52
117 0.62
118 0.73
119 0.81
120 0.88
121 0.91
122 0.92
123 0.92
124 0.94
125 0.92
126 0.92
127 0.92
128 0.88
129 0.85
130 0.8
131 0.78
132 0.7
133 0.63
134 0.54
135 0.43
136 0.38
137 0.33
138 0.32
139 0.25
140 0.23
141 0.23
142 0.22
143 0.23
144 0.22
145 0.23
146 0.23
147 0.23
148 0.24
149 0.29
150 0.3
151 0.3
152 0.29
153 0.27
154 0.23
155 0.22
156 0.2
157 0.14
158 0.13
159 0.14
160 0.13
161 0.11
162 0.12
163 0.13
164 0.15
165 0.19
166 0.21
167 0.2
168 0.23
169 0.29
170 0.36
171 0.43
172 0.47
173 0.47
174 0.51
175 0.56
176 0.56
177 0.54
178 0.49
179 0.42
180 0.37
181 0.35
182 0.3
183 0.23
184 0.22
185 0.18
186 0.14
187 0.11