Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139I9C2

Protein Details
Accession A0A139I9C2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
155-175AAATKPKRKTKGKKDAEDPESBasic
NLS Segment(s)
PositionSequence
152-168KQAAAATKPKRKTKGKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
IPR031127  E3_UB_ligase_RBR  
IPR002867  IBR_dom  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF01485  IBR  
CDD cd20335  BRcat_RBR  
Amino Acid Sequences MLTRKRAAEANQPPQATTLDDVPAIIKKKANIASARYLCTTCDTEKTAKSFPDYNPSADCHHLINTCKSCLKEWVGVRIESAEFAKGPDGDSFGVKCPECPATMRPVNVQAAVTKTVFAKFSKAHRHFIGEVTPGWRWCLAPGCNAGQVHKKQAAAATKPKRKTKGKKDAEDPESSQPDICTCQKCGAQACVSCDRPYHNGEDCQTYQRRTKDRMDEEEMSHGAQEHEALNNFVKETLRLHSPVPPDARGDEAEEFDPSRWNSIRPTFEYLPFNAEPCICPFMPKRSRDFDDGQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.37
4 0.29
5 0.22
6 0.17
7 0.16
8 0.16
9 0.16
10 0.2
11 0.21
12 0.22
13 0.21
14 0.21
15 0.29
16 0.34
17 0.39
18 0.4
19 0.42
20 0.5
21 0.51
22 0.52
23 0.47
24 0.42
25 0.36
26 0.35
27 0.34
28 0.26
29 0.26
30 0.27
31 0.3
32 0.34
33 0.37
34 0.37
35 0.35
36 0.37
37 0.39
38 0.36
39 0.42
40 0.4
41 0.38
42 0.36
43 0.36
44 0.35
45 0.32
46 0.31
47 0.23
48 0.24
49 0.25
50 0.26
51 0.33
52 0.32
53 0.33
54 0.35
55 0.35
56 0.34
57 0.35
58 0.36
59 0.34
60 0.34
61 0.39
62 0.39
63 0.38
64 0.36
65 0.33
66 0.28
67 0.22
68 0.21
69 0.13
70 0.09
71 0.1
72 0.11
73 0.09
74 0.1
75 0.1
76 0.11
77 0.11
78 0.12
79 0.12
80 0.13
81 0.17
82 0.16
83 0.15
84 0.16
85 0.17
86 0.16
87 0.18
88 0.18
89 0.23
90 0.26
91 0.27
92 0.26
93 0.28
94 0.29
95 0.27
96 0.25
97 0.18
98 0.17
99 0.18
100 0.16
101 0.13
102 0.12
103 0.13
104 0.14
105 0.13
106 0.14
107 0.15
108 0.22
109 0.33
110 0.36
111 0.39
112 0.38
113 0.42
114 0.4
115 0.38
116 0.34
117 0.25
118 0.22
119 0.2
120 0.19
121 0.15
122 0.15
123 0.14
124 0.11
125 0.1
126 0.15
127 0.13
128 0.15
129 0.17
130 0.18
131 0.2
132 0.2
133 0.21
134 0.22
135 0.22
136 0.23
137 0.24
138 0.23
139 0.2
140 0.24
141 0.27
142 0.25
143 0.34
144 0.4
145 0.44
146 0.51
147 0.56
148 0.61
149 0.66
150 0.73
151 0.74
152 0.76
153 0.79
154 0.79
155 0.81
156 0.82
157 0.76
158 0.7
159 0.62
160 0.56
161 0.49
162 0.42
163 0.34
164 0.24
165 0.21
166 0.21
167 0.22
168 0.18
169 0.17
170 0.21
171 0.22
172 0.24
173 0.26
174 0.26
175 0.26
176 0.25
177 0.29
178 0.32
179 0.32
180 0.31
181 0.29
182 0.28
183 0.28
184 0.28
185 0.28
186 0.26
187 0.28
188 0.29
189 0.34
190 0.32
191 0.36
192 0.37
193 0.36
194 0.38
195 0.42
196 0.47
197 0.46
198 0.53
199 0.56
200 0.6
201 0.63
202 0.64
203 0.6
204 0.56
205 0.54
206 0.46
207 0.36
208 0.29
209 0.22
210 0.15
211 0.12
212 0.11
213 0.08
214 0.1
215 0.1
216 0.12
217 0.13
218 0.13
219 0.13
220 0.14
221 0.13
222 0.12
223 0.14
224 0.15
225 0.18
226 0.19
227 0.2
228 0.24
229 0.26
230 0.32
231 0.34
232 0.32
233 0.3
234 0.3
235 0.31
236 0.27
237 0.27
238 0.23
239 0.21
240 0.2
241 0.2
242 0.2
243 0.17
244 0.22
245 0.18
246 0.23
247 0.21
248 0.23
249 0.28
250 0.34
251 0.4
252 0.4
253 0.48
254 0.46
255 0.5
256 0.52
257 0.47
258 0.46
259 0.4
260 0.37
261 0.3
262 0.28
263 0.24
264 0.24
265 0.28
266 0.21
267 0.26
268 0.3
269 0.38
270 0.46
271 0.5
272 0.53
273 0.57
274 0.62
275 0.64