Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139H7Y8

Protein Details
Accession A0A139H7Y8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
257-284IRYDFSVPTGRKNRRRRRLDLQAAVEERHydrophilic
NLS Segment(s)
PositionSequence
267-273RKNRRRR
Subcellular Location(s) nucl 11.5, cyto_nucl 9.833, cyto 7, mito 6, cyto_pero 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
Pfam View protein in Pfam  
PF01636  APH  
Amino Acid Sequences MNNFYASSLSRRVVMQFCDDPDRNTIGRMNSNPEVIRVGDMVIKFGRVSLEEACNQHAAATLVNPEVLVVPKVYDYFQSGDRAFLVMQFVQGRHPTVREYSSVLPEVAKSLAYLHTFTRHYPGPYAPGRSLGLLWCDDVNVLSFVSKDALASYLNSRLRDKTYAFDFKSTTMVFCHLDVAPRNIVVTNDRICLLDWESAGFYPRSLERCAIRRNCGNHGEDGEYCTWMDYYSGLQEPLSPEELLQAQMVDRVVGNNIRYDFSVPTGRKNRRRRRLDLQAAVEERQTDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.32
4 0.34
5 0.41
6 0.41
7 0.38
8 0.38
9 0.4
10 0.33
11 0.32
12 0.33
13 0.29
14 0.35
15 0.36
16 0.39
17 0.36
18 0.4
19 0.38
20 0.35
21 0.32
22 0.26
23 0.24
24 0.17
25 0.16
26 0.15
27 0.15
28 0.16
29 0.14
30 0.14
31 0.12
32 0.13
33 0.13
34 0.11
35 0.14
36 0.14
37 0.18
38 0.21
39 0.23
40 0.24
41 0.24
42 0.22
43 0.2
44 0.18
45 0.14
46 0.11
47 0.11
48 0.1
49 0.1
50 0.1
51 0.09
52 0.08
53 0.08
54 0.09
55 0.08
56 0.07
57 0.07
58 0.08
59 0.09
60 0.09
61 0.09
62 0.11
63 0.12
64 0.14
65 0.19
66 0.18
67 0.18
68 0.18
69 0.18
70 0.15
71 0.14
72 0.14
73 0.09
74 0.11
75 0.12
76 0.12
77 0.13
78 0.15
79 0.16
80 0.15
81 0.16
82 0.16
83 0.17
84 0.19
85 0.18
86 0.2
87 0.2
88 0.22
89 0.22
90 0.2
91 0.18
92 0.16
93 0.16
94 0.12
95 0.1
96 0.07
97 0.07
98 0.1
99 0.1
100 0.11
101 0.11
102 0.15
103 0.16
104 0.16
105 0.19
106 0.18
107 0.18
108 0.19
109 0.2
110 0.21
111 0.23
112 0.26
113 0.22
114 0.23
115 0.22
116 0.2
117 0.2
118 0.14
119 0.13
120 0.1
121 0.1
122 0.08
123 0.07
124 0.07
125 0.06
126 0.06
127 0.05
128 0.05
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.05
137 0.05
138 0.06
139 0.07
140 0.13
141 0.16
142 0.17
143 0.18
144 0.19
145 0.22
146 0.24
147 0.24
148 0.21
149 0.25
150 0.31
151 0.3
152 0.31
153 0.29
154 0.26
155 0.29
156 0.25
157 0.2
158 0.13
159 0.15
160 0.13
161 0.13
162 0.14
163 0.11
164 0.14
165 0.15
166 0.17
167 0.15
168 0.15
169 0.15
170 0.13
171 0.14
172 0.12
173 0.15
174 0.14
175 0.14
176 0.15
177 0.15
178 0.15
179 0.16
180 0.16
181 0.14
182 0.12
183 0.12
184 0.12
185 0.12
186 0.14
187 0.12
188 0.09
189 0.09
190 0.12
191 0.14
192 0.16
193 0.19
194 0.22
195 0.29
196 0.38
197 0.41
198 0.45
199 0.48
200 0.51
201 0.54
202 0.56
203 0.51
204 0.44
205 0.42
206 0.39
207 0.32
208 0.31
209 0.26
210 0.2
211 0.18
212 0.15
213 0.13
214 0.1
215 0.1
216 0.07
217 0.07
218 0.1
219 0.11
220 0.11
221 0.11
222 0.13
223 0.15
224 0.17
225 0.18
226 0.15
227 0.14
228 0.16
229 0.17
230 0.16
231 0.14
232 0.11
233 0.09
234 0.11
235 0.11
236 0.09
237 0.09
238 0.08
239 0.11
240 0.14
241 0.15
242 0.17
243 0.19
244 0.19
245 0.2
246 0.22
247 0.2
248 0.21
249 0.3
250 0.26
251 0.35
252 0.44
253 0.53
254 0.61
255 0.71
256 0.78
257 0.8
258 0.89
259 0.87
260 0.88
261 0.89
262 0.9
263 0.88
264 0.83
265 0.81
266 0.75
267 0.68
268 0.58