Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139IQC6

Protein Details
Accession A0A139IQC6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
104-124GKYIGPYKPKVKKQGIKVGRSHydrophilic
NLS Segment(s)
PositionSequence
113-117KVKKQ
Subcellular Location(s) mito 10.5, nucl 9.5, cyto_mito 8.833, cyto_nucl 8.333, cyto 6
Family & Domain DBs
Amino Acid Sequences MECWRLLKCRAVEGNSDFGKKVGKERRIDWETSRRPIDIEFILIDARQDSVKERISKASREEKESRCLKEDFPFCTYVIPEEVGAAIKVAECMSIEPASGNEGGKYIGPYKPKVKKQGIKVGRSAVETAAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.45
4 0.36
5 0.31
6 0.33
7 0.28
8 0.34
9 0.35
10 0.4
11 0.43
12 0.47
13 0.56
14 0.56
15 0.58
16 0.56
17 0.57
18 0.56
19 0.58
20 0.56
21 0.46
22 0.42
23 0.39
24 0.36
25 0.26
26 0.21
27 0.14
28 0.13
29 0.13
30 0.12
31 0.11
32 0.07
33 0.07
34 0.06
35 0.06
36 0.08
37 0.12
38 0.17
39 0.2
40 0.21
41 0.28
42 0.3
43 0.33
44 0.36
45 0.42
46 0.39
47 0.43
48 0.49
49 0.44
50 0.5
51 0.52
52 0.48
53 0.42
54 0.41
55 0.36
56 0.36
57 0.37
58 0.31
59 0.29
60 0.28
61 0.25
62 0.25
63 0.23
64 0.17
65 0.14
66 0.12
67 0.09
68 0.07
69 0.07
70 0.07
71 0.07
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.07
81 0.07
82 0.07
83 0.07
84 0.08
85 0.09
86 0.1
87 0.1
88 0.07
89 0.08
90 0.08
91 0.09
92 0.11
93 0.12
94 0.15
95 0.18
96 0.24
97 0.33
98 0.42
99 0.5
100 0.58
101 0.66
102 0.7
103 0.76
104 0.82
105 0.81
106 0.77
107 0.75
108 0.72
109 0.64
110 0.59
111 0.5
112 0.42