Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UWI4

Protein Details
Accession E4UWI4   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MASKNNILKRQQRQHQRLRGMGHydrophilic
NLS Segment(s)
PositionSequence
80-87RKAKIRGE
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
Amino Acid Sequences MASKNNILKRQQRQHQRLRGMGEDLSRRRPPPPLPPDYANGRAGREILAEQSSRKIGCHRAPPSTSPPTPEGQDEGQTRRKAKIRGEEKGGGGGIEGGRSGGDVTPKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.85
4 0.8
5 0.74
6 0.67
7 0.59
8 0.51
9 0.45
10 0.44
11 0.39
12 0.41
13 0.4
14 0.38
15 0.38
16 0.41
17 0.41
18 0.44
19 0.49
20 0.48
21 0.5
22 0.51
23 0.53
24 0.53
25 0.52
26 0.45
27 0.37
28 0.32
29 0.27
30 0.24
31 0.21
32 0.16
33 0.12
34 0.09
35 0.1
36 0.09
37 0.09
38 0.1
39 0.11
40 0.11
41 0.11
42 0.12
43 0.17
44 0.21
45 0.29
46 0.31
47 0.35
48 0.37
49 0.4
50 0.45
51 0.46
52 0.42
53 0.36
54 0.36
55 0.32
56 0.32
57 0.29
58 0.25
59 0.2
60 0.25
61 0.24
62 0.27
63 0.33
64 0.36
65 0.36
66 0.39
67 0.44
68 0.44
69 0.48
70 0.53
71 0.55
72 0.57
73 0.63
74 0.61
75 0.56
76 0.53
77 0.46
78 0.35
79 0.27
80 0.22
81 0.15
82 0.1
83 0.1
84 0.07
85 0.06
86 0.07
87 0.08
88 0.07