Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139I2A5

Protein Details
Accession A0A139I2A5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-32SAGGRRNKKLARERQRPTPTPNGQRPSHydrophilic
NLS Segment(s)
PositionSequence
10-20RRNKKLARERQ
Subcellular Location(s) plas 7, nucl 6, mito 4, extr 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADAGSAGGRRNKKLARERQRPTPTPNGQRPSRSICNDPILTHTGSSFAFWQQHFCFPSLRFICLQRELSRAMNSSHHQHHHHHHQSGPQRLSALYQYHNAPEVAPAHGLEYDDTIYPSSDKFPVIRESPAYDGKLGKYGFGGDNRPPRIIFGMKIRTFLLVALVMILIVVGAAVGGAVGGQQLRENQAQQTAVYTNGTNSPVTQSTSKGTPTSTYSAPTPTYTPINDCPDSNNTEYTSQFASGSSGSVPDHAELKFTKYCDLSNPLSQDGAQRIAEAYVYSFSDCVEVCAGYNFWNDGSNCTVAIYQSSGGRPGNCWVGNAGDVQASDLNTTQGTDVAILNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.7
4 0.76
5 0.8
6 0.82
7 0.87
8 0.84
9 0.81
10 0.8
11 0.79
12 0.79
13 0.82
14 0.8
15 0.76
16 0.75
17 0.74
18 0.72
19 0.71
20 0.65
21 0.61
22 0.58
23 0.6
24 0.56
25 0.51
26 0.47
27 0.42
28 0.37
29 0.32
30 0.26
31 0.2
32 0.18
33 0.19
34 0.15
35 0.15
36 0.19
37 0.18
38 0.25
39 0.25
40 0.31
41 0.32
42 0.32
43 0.33
44 0.29
45 0.39
46 0.35
47 0.35
48 0.31
49 0.33
50 0.37
51 0.39
52 0.43
53 0.35
54 0.36
55 0.37
56 0.38
57 0.37
58 0.33
59 0.29
60 0.3
61 0.29
62 0.33
63 0.37
64 0.39
65 0.4
66 0.44
67 0.5
68 0.56
69 0.61
70 0.58
71 0.54
72 0.56
73 0.6
74 0.64
75 0.57
76 0.47
77 0.4
78 0.36
79 0.35
80 0.32
81 0.27
82 0.2
83 0.21
84 0.21
85 0.21
86 0.23
87 0.21
88 0.16
89 0.16
90 0.15
91 0.13
92 0.12
93 0.11
94 0.11
95 0.11
96 0.11
97 0.09
98 0.09
99 0.08
100 0.08
101 0.09
102 0.08
103 0.08
104 0.08
105 0.08
106 0.09
107 0.1
108 0.1
109 0.11
110 0.13
111 0.17
112 0.19
113 0.2
114 0.19
115 0.2
116 0.23
117 0.26
118 0.24
119 0.21
120 0.2
121 0.19
122 0.23
123 0.2
124 0.17
125 0.14
126 0.15
127 0.16
128 0.17
129 0.19
130 0.19
131 0.27
132 0.28
133 0.29
134 0.27
135 0.25
136 0.26
137 0.24
138 0.21
139 0.21
140 0.29
141 0.28
142 0.3
143 0.29
144 0.26
145 0.25
146 0.23
147 0.17
148 0.07
149 0.07
150 0.05
151 0.05
152 0.04
153 0.04
154 0.03
155 0.02
156 0.02
157 0.02
158 0.01
159 0.01
160 0.01
161 0.01
162 0.01
163 0.01
164 0.01
165 0.01
166 0.02
167 0.02
168 0.02
169 0.03
170 0.04
171 0.07
172 0.08
173 0.09
174 0.1
175 0.12
176 0.12
177 0.12
178 0.13
179 0.1
180 0.1
181 0.1
182 0.1
183 0.08
184 0.1
185 0.12
186 0.1
187 0.1
188 0.12
189 0.12
190 0.14
191 0.14
192 0.13
193 0.14
194 0.16
195 0.17
196 0.15
197 0.15
198 0.15
199 0.17
200 0.19
201 0.18
202 0.18
203 0.17
204 0.19
205 0.2
206 0.19
207 0.17
208 0.16
209 0.18
210 0.17
211 0.2
212 0.23
213 0.28
214 0.27
215 0.26
216 0.28
217 0.28
218 0.32
219 0.3
220 0.26
221 0.22
222 0.23
223 0.23
224 0.21
225 0.19
226 0.15
227 0.14
228 0.12
229 0.12
230 0.1
231 0.11
232 0.08
233 0.08
234 0.08
235 0.09
236 0.09
237 0.09
238 0.11
239 0.1
240 0.13
241 0.13
242 0.18
243 0.19
244 0.19
245 0.22
246 0.21
247 0.22
248 0.24
249 0.3
250 0.28
251 0.31
252 0.33
253 0.3
254 0.29
255 0.29
256 0.28
257 0.24
258 0.24
259 0.19
260 0.16
261 0.16
262 0.15
263 0.15
264 0.12
265 0.1
266 0.08
267 0.09
268 0.09
269 0.08
270 0.08
271 0.1
272 0.09
273 0.1
274 0.1
275 0.09
276 0.09
277 0.11
278 0.11
279 0.11
280 0.13
281 0.12
282 0.11
283 0.16
284 0.16
285 0.17
286 0.21
287 0.19
288 0.18
289 0.18
290 0.18
291 0.14
292 0.15
293 0.14
294 0.12
295 0.14
296 0.15
297 0.18
298 0.2
299 0.21
300 0.21
301 0.23
302 0.3
303 0.27
304 0.27
305 0.24
306 0.24
307 0.24
308 0.23
309 0.2
310 0.14
311 0.13
312 0.14
313 0.15
314 0.13
315 0.13
316 0.13
317 0.13
318 0.12
319 0.13
320 0.11
321 0.1
322 0.1
323 0.1