Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139INS6

Protein Details
Accession A0A139INS6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-104TTPAKKKSTPGKRKKATTPPQGSHydrophilic
NLS Segment(s)
PositionSequence
85-97AKKKSTPGKRKKA
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, mito_nucl 10.666, cyto 6
Family & Domain DBs
Amino Acid Sequences MPLSEKQMKYLALAWQCFDTEPKASDIPIKLPIDYEKFAQVAGLKSSASARELMRVTKNKLKEEYGALSGQVQTTNSNNNHTTPAKKKSTPGKRKKATTPPQGSGDEDGGDDEERKTPASKRVKKTATKAPPVVKSEPTQDDSDEDGLSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.28
4 0.26
5 0.24
6 0.2
7 0.17
8 0.18
9 0.2
10 0.2
11 0.2
12 0.24
13 0.24
14 0.24
15 0.28
16 0.27
17 0.24
18 0.25
19 0.28
20 0.28
21 0.27
22 0.26
23 0.2
24 0.2
25 0.19
26 0.19
27 0.17
28 0.14
29 0.14
30 0.13
31 0.11
32 0.11
33 0.13
34 0.12
35 0.11
36 0.12
37 0.11
38 0.15
39 0.16
40 0.18
41 0.24
42 0.28
43 0.33
44 0.36
45 0.4
46 0.4
47 0.42
48 0.41
49 0.36
50 0.35
51 0.32
52 0.28
53 0.24
54 0.19
55 0.17
56 0.15
57 0.14
58 0.1
59 0.08
60 0.07
61 0.08
62 0.13
63 0.13
64 0.16
65 0.17
66 0.18
67 0.21
68 0.22
69 0.27
70 0.27
71 0.34
72 0.36
73 0.37
74 0.42
75 0.48
76 0.58
77 0.64
78 0.69
79 0.72
80 0.74
81 0.79
82 0.82
83 0.83
84 0.82
85 0.81
86 0.78
87 0.71
88 0.68
89 0.63
90 0.56
91 0.47
92 0.37
93 0.27
94 0.19
95 0.16
96 0.12
97 0.11
98 0.1
99 0.09
100 0.1
101 0.1
102 0.11
103 0.14
104 0.16
105 0.26
106 0.36
107 0.45
108 0.5
109 0.6
110 0.68
111 0.73
112 0.77
113 0.78
114 0.77
115 0.77
116 0.77
117 0.74
118 0.73
119 0.71
120 0.68
121 0.61
122 0.54
123 0.53
124 0.51
125 0.47
126 0.41
127 0.36
128 0.35
129 0.34
130 0.33
131 0.25