Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139IVL8

Protein Details
Accession A0A139IVL8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
165-184LREFRRMKKEAEKKEKESGNBasic
NLS Segment(s)
PositionSequence
172-178KKEAEKK
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 4, extr 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR023389  DOPA-like_sf  
IPR014980  DOPA_dioxygen  
Pfam View protein in Pfam  
PF08883  DOPA_dioxygen  
Amino Acid Sequences MDPTLYEYPSPLEGWENHEPLTNERNEDGKSLKTPSPTTQSPAYSQFTSPITNDIRGGFDVHIYFLQSNPLEVNFAKALHSRIRLEFPELRIYQVWEKPIGPHPVGMFEVNLFTPQQFGAFVPWLVINRGPLSALVHPNTGEDERDHTQRATWMGIPYPLQTGMLREFRRMKKEAEKKEKESGNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.29
4 0.27
5 0.31
6 0.31
7 0.32
8 0.37
9 0.32
10 0.28
11 0.28
12 0.3
13 0.27
14 0.29
15 0.27
16 0.24
17 0.25
18 0.27
19 0.28
20 0.3
21 0.32
22 0.34
23 0.39
24 0.37
25 0.38
26 0.38
27 0.38
28 0.37
29 0.39
30 0.38
31 0.32
32 0.3
33 0.29
34 0.26
35 0.25
36 0.22
37 0.22
38 0.2
39 0.2
40 0.2
41 0.18
42 0.18
43 0.17
44 0.18
45 0.13
46 0.12
47 0.11
48 0.11
49 0.11
50 0.1
51 0.1
52 0.08
53 0.12
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.13
61 0.1
62 0.1
63 0.11
64 0.12
65 0.14
66 0.16
67 0.19
68 0.18
69 0.19
70 0.22
71 0.21
72 0.25
73 0.25
74 0.24
75 0.28
76 0.26
77 0.26
78 0.23
79 0.24
80 0.23
81 0.22
82 0.21
83 0.15
84 0.16
85 0.16
86 0.22
87 0.24
88 0.2
89 0.2
90 0.19
91 0.2
92 0.2
93 0.18
94 0.13
95 0.09
96 0.09
97 0.08
98 0.08
99 0.07
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.08
108 0.08
109 0.08
110 0.09
111 0.1
112 0.1
113 0.11
114 0.1
115 0.1
116 0.1
117 0.1
118 0.09
119 0.12
120 0.14
121 0.18
122 0.18
123 0.18
124 0.18
125 0.18
126 0.2
127 0.18
128 0.16
129 0.13
130 0.17
131 0.2
132 0.22
133 0.24
134 0.22
135 0.22
136 0.24
137 0.25
138 0.22
139 0.22
140 0.21
141 0.2
142 0.22
143 0.22
144 0.2
145 0.2
146 0.18
147 0.16
148 0.15
149 0.17
150 0.2
151 0.28
152 0.28
153 0.32
154 0.41
155 0.46
156 0.53
157 0.53
158 0.54
159 0.57
160 0.66
161 0.71
162 0.73
163 0.76
164 0.74
165 0.81