Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HIS9

Protein Details
Accession A0A139HIS9    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
115-138AQYTNDCVRYKRKKNGRKQSEKNVHydrophilic
NLS Segment(s)
PositionSequence
83-86ARGK
125-132KRKKNGRK
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
CDD cd06257  DnaJ  
Amino Acid Sequences MDEPEQQDHYAILSISVDATTKEIKSRARKLYLLHHLDKGGNPEQFCKLRKSLEMTKIDPYLMENTLTYGNPGERTIGVEKRARGKTRRFFEESMKKLNSVHKKLYGGLSRRKSAQYTNDCVRYKRKKNGRKQSEKNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.06
6 0.09
7 0.1
8 0.11
9 0.14
10 0.18
11 0.25
12 0.34
13 0.43
14 0.49
15 0.52
16 0.54
17 0.55
18 0.61
19 0.63
20 0.61
21 0.55
22 0.49
23 0.45
24 0.44
25 0.41
26 0.37
27 0.32
28 0.27
29 0.25
30 0.25
31 0.29
32 0.32
33 0.33
34 0.31
35 0.29
36 0.29
37 0.31
38 0.36
39 0.38
40 0.42
41 0.45
42 0.43
43 0.43
44 0.41
45 0.39
46 0.31
47 0.25
48 0.19
49 0.14
50 0.12
51 0.09
52 0.09
53 0.11
54 0.1
55 0.09
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.07
62 0.09
63 0.12
64 0.14
65 0.17
66 0.2
67 0.22
68 0.29
69 0.35
70 0.38
71 0.41
72 0.49
73 0.54
74 0.58
75 0.63
76 0.6
77 0.57
78 0.62
79 0.66
80 0.6
81 0.58
82 0.52
83 0.46
84 0.43
85 0.5
86 0.5
87 0.45
88 0.47
89 0.44
90 0.45
91 0.46
92 0.51
93 0.5
94 0.47
95 0.51
96 0.52
97 0.5
98 0.51
99 0.52
100 0.48
101 0.47
102 0.5
103 0.49
104 0.5
105 0.55
106 0.6
107 0.6
108 0.61
109 0.65
110 0.65
111 0.67
112 0.7
113 0.73
114 0.75
115 0.83
116 0.91
117 0.92
118 0.92