Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4US25

Protein Details
Accession E4US25    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-45REMTRLKSGKPDRYKPKQWQEARKRGPLPBasic
NLS Segment(s)
PositionSequence
25-34GKPDRYKPKQ
39-39R
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, pero 4, mito 3
Family & Domain DBs
Amino Acid Sequences MDLDPVEYPVDSPQWRREMTRLKSGKPDRYKPKQWQEARKRGPLPESPWLEPVLLRGSLDTPEKIQEHAGLSERPEVQSAQTVTDTLLHPADKLETVQYCMVAGYGYFRLKEKYQVRETTLLIDGKKRGGHIFHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.37
4 0.44
5 0.49
6 0.51
7 0.58
8 0.56
9 0.53
10 0.62
11 0.67
12 0.69
13 0.68
14 0.72
15 0.72
16 0.77
17 0.83
18 0.83
19 0.86
20 0.86
21 0.85
22 0.87
23 0.87
24 0.88
25 0.85
26 0.83
27 0.76
28 0.69
29 0.65
30 0.6
31 0.54
32 0.52
33 0.5
34 0.43
35 0.41
36 0.38
37 0.33
38 0.27
39 0.23
40 0.17
41 0.12
42 0.1
43 0.09
44 0.09
45 0.11
46 0.12
47 0.11
48 0.09
49 0.12
50 0.12
51 0.12
52 0.12
53 0.12
54 0.12
55 0.12
56 0.14
57 0.11
58 0.12
59 0.14
60 0.14
61 0.13
62 0.13
63 0.12
64 0.11
65 0.14
66 0.14
67 0.12
68 0.12
69 0.12
70 0.11
71 0.14
72 0.13
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.11
79 0.09
80 0.09
81 0.11
82 0.1
83 0.13
84 0.13
85 0.13
86 0.12
87 0.11
88 0.11
89 0.08
90 0.07
91 0.07
92 0.1
93 0.12
94 0.12
95 0.14
96 0.17
97 0.19
98 0.29
99 0.33
100 0.38
101 0.45
102 0.5
103 0.53
104 0.54
105 0.54
106 0.48
107 0.46
108 0.4
109 0.34
110 0.33
111 0.3
112 0.3
113 0.31
114 0.29
115 0.29