Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IDH7

Protein Details
Accession A0A139IDH7   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
118-137GPMPVCTRLRLRRNACPPRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 8.5, cyto_nucl 7.833, cyto_pero 5.666, nucl 5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045087  Cu-oxidase_fam  
IPR011707  Cu-oxidase_N  
IPR008972  Cupredoxin  
Gene Ontology GO:0005507  F:copper ion binding  
Pfam View protein in Pfam  
PF07732  Cu-oxidase_3  
Amino Acid Sequences MPITYRTREYNFVITNTTISSGGVERIALFVNGQMPGPKIEASWGNTVVVHVTNAMQNNGTSIHFHGIRQNYTNKMDSITQCALAPGESMTYTWKATNYGSSWYHSNFAIQTYEGVFGPMPVCTRLRLRRNACPPRLVSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.27
4 0.25
5 0.16
6 0.13
7 0.13
8 0.11
9 0.11
10 0.1
11 0.1
12 0.08
13 0.09
14 0.09
15 0.08
16 0.07
17 0.07
18 0.09
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.12
25 0.11
26 0.09
27 0.11
28 0.14
29 0.17
30 0.19
31 0.18
32 0.17
33 0.17
34 0.17
35 0.16
36 0.12
37 0.09
38 0.06
39 0.06
40 0.08
41 0.09
42 0.09
43 0.09
44 0.08
45 0.09
46 0.1
47 0.09
48 0.08
49 0.08
50 0.1
51 0.1
52 0.11
53 0.15
54 0.16
55 0.17
56 0.2
57 0.21
58 0.22
59 0.24
60 0.26
61 0.21
62 0.2
63 0.22
64 0.2
65 0.23
66 0.2
67 0.18
68 0.17
69 0.17
70 0.15
71 0.12
72 0.11
73 0.05
74 0.05
75 0.05
76 0.05
77 0.07
78 0.08
79 0.09
80 0.1
81 0.1
82 0.11
83 0.12
84 0.15
85 0.15
86 0.18
87 0.19
88 0.21
89 0.23
90 0.23
91 0.24
92 0.2
93 0.21
94 0.16
95 0.16
96 0.15
97 0.13
98 0.12
99 0.12
100 0.13
101 0.11
102 0.12
103 0.1
104 0.09
105 0.1
106 0.1
107 0.1
108 0.11
109 0.12
110 0.15
111 0.24
112 0.32
113 0.41
114 0.5
115 0.55
116 0.63
117 0.74
118 0.81
119 0.78
120 0.77