Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139H3W7

Protein Details
Accession A0A139H3W7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-87ANRACDKCRRLKKGGCEESEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, mito 5
Family & Domain DBs
Amino Acid Sequences MAGAYVAGCQPDGESRYWTIRELAEAISEDSNYQWHPADLDTTAAIMHISCRRCTKSLASGTLHGRAANRACDKCRRLKKGGCEESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.24
4 0.25
5 0.25
6 0.23
7 0.21
8 0.21
9 0.19
10 0.17
11 0.14
12 0.13
13 0.14
14 0.12
15 0.12
16 0.1
17 0.09
18 0.09
19 0.08
20 0.09
21 0.07
22 0.07
23 0.08
24 0.08
25 0.09
26 0.08
27 0.08
28 0.07
29 0.06
30 0.06
31 0.05
32 0.05
33 0.04
34 0.06
35 0.09
36 0.11
37 0.13
38 0.17
39 0.2
40 0.22
41 0.25
42 0.27
43 0.32
44 0.36
45 0.39
46 0.38
47 0.4
48 0.41
49 0.42
50 0.38
51 0.3
52 0.25
53 0.25
54 0.25
55 0.28
56 0.33
57 0.33
58 0.37
59 0.46
60 0.51
61 0.57
62 0.65
63 0.65
64 0.68
65 0.72
66 0.78
67 0.8