Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139ICN2

Protein Details
Accession A0A139ICN2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
198-222GKTSSTPKHKVKARKGKCSRKDATLHydrophilic
NLS Segment(s)
PositionSequence
205-214KHKVKARKGK
Subcellular Location(s) nucl 15, cyto_nucl 14, cyto 9
Family & Domain DBs
Amino Acid Sequences MLAAETSAELQQIVKVPNTHKGAMAIWAKKAADSSDSDVEMTRLRAMLDRADVEHVCIGKLHAQNLHKKGSSPNWERYNFSPLYRDRNYKEKKERTQEVVEYFGGLYESRATKLKRCQALLSITRCKEILKDSGSRGCFIIIRDFIEADRKAYRFPAVEPLRYYSIIVYGKSCESVGKRVQNLKLTYTAGWEKDGADGKTSSTPKHKVKARKGKCSRKDATLVHSQVPIRGGNDGSAVSANKVSDSDGTSEPETPSDENMGVVIDLIRSSAFQMESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.25
4 0.34
5 0.38
6 0.37
7 0.33
8 0.33
9 0.31
10 0.34
11 0.39
12 0.33
13 0.3
14 0.33
15 0.31
16 0.3
17 0.3
18 0.24
19 0.19
20 0.2
21 0.24
22 0.24
23 0.24
24 0.24
25 0.23
26 0.23
27 0.22
28 0.19
29 0.15
30 0.11
31 0.11
32 0.14
33 0.15
34 0.17
35 0.18
36 0.18
37 0.18
38 0.22
39 0.21
40 0.2
41 0.21
42 0.18
43 0.15
44 0.14
45 0.14
46 0.17
47 0.19
48 0.2
49 0.24
50 0.28
51 0.37
52 0.41
53 0.46
54 0.4
55 0.39
56 0.42
57 0.45
58 0.51
59 0.48
60 0.53
61 0.56
62 0.57
63 0.58
64 0.55
65 0.54
66 0.45
67 0.4
68 0.38
69 0.32
70 0.39
71 0.4
72 0.44
73 0.4
74 0.49
75 0.55
76 0.57
77 0.65
78 0.67
79 0.71
80 0.75
81 0.78
82 0.73
83 0.72
84 0.67
85 0.58
86 0.51
87 0.42
88 0.33
89 0.27
90 0.2
91 0.14
92 0.1
93 0.08
94 0.07
95 0.08
96 0.09
97 0.13
98 0.14
99 0.19
100 0.27
101 0.34
102 0.37
103 0.38
104 0.38
105 0.38
106 0.44
107 0.44
108 0.43
109 0.43
110 0.39
111 0.38
112 0.36
113 0.32
114 0.27
115 0.23
116 0.22
117 0.18
118 0.21
119 0.22
120 0.27
121 0.28
122 0.27
123 0.24
124 0.2
125 0.18
126 0.15
127 0.17
128 0.12
129 0.13
130 0.12
131 0.12
132 0.12
133 0.16
134 0.15
135 0.14
136 0.16
137 0.16
138 0.16
139 0.17
140 0.19
141 0.14
142 0.15
143 0.23
144 0.23
145 0.25
146 0.26
147 0.28
148 0.28
149 0.27
150 0.27
151 0.16
152 0.19
153 0.17
154 0.17
155 0.14
156 0.14
157 0.14
158 0.14
159 0.14
160 0.11
161 0.12
162 0.17
163 0.22
164 0.27
165 0.31
166 0.36
167 0.4
168 0.45
169 0.44
170 0.41
171 0.38
172 0.34
173 0.3
174 0.28
175 0.27
176 0.21
177 0.2
178 0.19
179 0.16
180 0.18
181 0.22
182 0.18
183 0.18
184 0.17
185 0.18
186 0.24
187 0.25
188 0.24
189 0.27
190 0.35
191 0.39
192 0.47
193 0.53
194 0.57
195 0.67
196 0.75
197 0.77
198 0.8
199 0.85
200 0.88
201 0.9
202 0.89
203 0.83
204 0.78
205 0.77
206 0.69
207 0.64
208 0.63
209 0.56
210 0.48
211 0.48
212 0.41
213 0.35
214 0.34
215 0.3
216 0.2
217 0.2
218 0.18
219 0.14
220 0.15
221 0.13
222 0.12
223 0.12
224 0.12
225 0.11
226 0.13
227 0.12
228 0.11
229 0.11
230 0.12
231 0.12
232 0.14
233 0.16
234 0.17
235 0.2
236 0.21
237 0.23
238 0.22
239 0.22
240 0.22
241 0.19
242 0.19
243 0.19
244 0.17
245 0.15
246 0.15
247 0.14
248 0.11
249 0.1
250 0.09
251 0.06
252 0.06
253 0.06
254 0.06
255 0.06
256 0.07
257 0.1