Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W7C2

Protein Details
Accession G0W7C2    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-76TKLVNYCKKSPKFRKLSPTDRFIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7, golg 6, nucl 4, mito 3, E.R. 3, extr 2, cyto_nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013726  DUF1748_fun  
Gene Ontology GO:0016020  C:membrane  
KEGG ndi:NDAI_0C00220  -  
Pfam View protein in Pfam  
PF08520  DUF1748  
Amino Acid Sequences MSVKSIIHIGFDMTLIAMLLAAIRRDTGLILKYEKFDFSTVIYGYLNWGEHWYTKLVNYCKKSPKFRKLSPTDRFIDDDNTTTIGRIEELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.04
5 0.03
6 0.04
7 0.04
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.08
15 0.09
16 0.11
17 0.14
18 0.15
19 0.17
20 0.17
21 0.18
22 0.17
23 0.15
24 0.14
25 0.12
26 0.14
27 0.12
28 0.12
29 0.11
30 0.1
31 0.1
32 0.1
33 0.09
34 0.06
35 0.07
36 0.07
37 0.07
38 0.09
39 0.09
40 0.09
41 0.11
42 0.17
43 0.22
44 0.28
45 0.32
46 0.39
47 0.47
48 0.54
49 0.63
50 0.67
51 0.73
52 0.75
53 0.78
54 0.81
55 0.81
56 0.84
57 0.8
58 0.77
59 0.7
60 0.63
61 0.58
62 0.5
63 0.46
64 0.37
65 0.32
66 0.27
67 0.26
68 0.23
69 0.21
70 0.19
71 0.14