Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139GTZ6

Protein Details
Accession A0A139GTZ6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-73GTRARDRKIRSTNSDRHHREBasic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 5, cyto 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MATSSFETLFTGTNIVFRRKVLCGLNAVLGLEQKRHGKRLPSEVFAWPRVSAAGTRARDRKIRSTNSDRHHREGAWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.2
4 0.2
5 0.23
6 0.23
7 0.28
8 0.26
9 0.25
10 0.24
11 0.24
12 0.25
13 0.22
14 0.2
15 0.15
16 0.14
17 0.12
18 0.1
19 0.11
20 0.17
21 0.18
22 0.21
23 0.23
24 0.28
25 0.31
26 0.4
27 0.41
28 0.38
29 0.39
30 0.41
31 0.42
32 0.38
33 0.35
34 0.25
35 0.22
36 0.19
37 0.17
38 0.12
39 0.13
40 0.19
41 0.21
42 0.26
43 0.31
44 0.34
45 0.4
46 0.44
47 0.51
48 0.52
49 0.58
50 0.61
51 0.67
52 0.72
53 0.75
54 0.81
55 0.77
56 0.73
57 0.7