Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139ILD9

Protein Details
Accession A0A139ILD9   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPRARRTTRYRRYKKADLVRFARHRRLTHydrophilic
NLS Segment(s)
PositionSequence
13-13R
15-15K
Subcellular Location(s) nucl 12, mito 11.5, cyto_mito 7.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MAPRARRTTRYRRYKKADLVRFARHRRLTVSSSRPGKSPHYSDYAKALEAADRDATFRFLDLAPELRTLIYNDLLILDDSFTCFPQILRTCKQIKNEATNTLYGHNLIDIRIRPDNIRAHGQLCGDYSPIAADLSLSDTSKIHWPDLLHRAQFIRVSLASNVWRNLRTRPATALSDLSKRIIIGGIVHSLCEFLAKKHRLRRIQFDFDLVAHDGVQLHQTLYPVRLLGSTVQVPTLRGLPVVPLQGELDIDLLAAGPWKRLIVIHRCHNVASRALSIMVGGQGANLDILLFGALTAADVLKWAAHEPYHLRDVLITIFEKAISRIRSILNESAPALGGDWRNEALLYEMYQLFRLDIDLKVAKLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.9
4 0.89
5 0.88
6 0.85
7 0.84
8 0.85
9 0.83
10 0.83
11 0.77
12 0.7
13 0.65
14 0.64
15 0.6
16 0.59
17 0.59
18 0.59
19 0.61
20 0.6
21 0.58
22 0.55
23 0.56
24 0.55
25 0.52
26 0.48
27 0.48
28 0.49
29 0.48
30 0.51
31 0.46
32 0.37
33 0.33
34 0.28
35 0.23
36 0.22
37 0.22
38 0.18
39 0.16
40 0.17
41 0.16
42 0.17
43 0.14
44 0.14
45 0.14
46 0.11
47 0.13
48 0.14
49 0.17
50 0.17
51 0.18
52 0.18
53 0.16
54 0.16
55 0.16
56 0.16
57 0.14
58 0.12
59 0.11
60 0.11
61 0.11
62 0.11
63 0.09
64 0.08
65 0.07
66 0.08
67 0.09
68 0.09
69 0.08
70 0.08
71 0.08
72 0.16
73 0.22
74 0.27
75 0.3
76 0.38
77 0.45
78 0.49
79 0.55
80 0.55
81 0.55
82 0.58
83 0.58
84 0.56
85 0.51
86 0.49
87 0.44
88 0.37
89 0.31
90 0.22
91 0.18
92 0.13
93 0.12
94 0.1
95 0.13
96 0.13
97 0.16
98 0.18
99 0.2
100 0.19
101 0.25
102 0.3
103 0.29
104 0.33
105 0.3
106 0.29
107 0.31
108 0.3
109 0.25
110 0.21
111 0.18
112 0.13
113 0.12
114 0.1
115 0.08
116 0.08
117 0.06
118 0.05
119 0.04
120 0.04
121 0.07
122 0.08
123 0.08
124 0.08
125 0.08
126 0.1
127 0.15
128 0.16
129 0.13
130 0.15
131 0.16
132 0.21
133 0.28
134 0.31
135 0.26
136 0.27
137 0.27
138 0.26
139 0.27
140 0.21
141 0.16
142 0.12
143 0.13
144 0.12
145 0.14
146 0.15
147 0.16
148 0.18
149 0.17
150 0.18
151 0.18
152 0.21
153 0.26
154 0.26
155 0.25
156 0.27
157 0.28
158 0.28
159 0.28
160 0.28
161 0.22
162 0.22
163 0.21
164 0.18
165 0.15
166 0.14
167 0.12
168 0.1
169 0.08
170 0.06
171 0.07
172 0.09
173 0.08
174 0.08
175 0.08
176 0.08
177 0.08
178 0.09
179 0.08
180 0.07
181 0.17
182 0.21
183 0.26
184 0.34
185 0.42
186 0.48
187 0.52
188 0.61
189 0.6
190 0.63
191 0.58
192 0.54
193 0.47
194 0.38
195 0.36
196 0.27
197 0.18
198 0.11
199 0.1
200 0.08
201 0.08
202 0.08
203 0.06
204 0.06
205 0.07
206 0.07
207 0.08
208 0.09
209 0.09
210 0.08
211 0.08
212 0.08
213 0.08
214 0.08
215 0.1
216 0.11
217 0.1
218 0.12
219 0.12
220 0.12
221 0.12
222 0.13
223 0.1
224 0.09
225 0.09
226 0.09
227 0.11
228 0.12
229 0.11
230 0.1
231 0.1
232 0.1
233 0.1
234 0.09
235 0.07
236 0.05
237 0.05
238 0.04
239 0.04
240 0.03
241 0.06
242 0.06
243 0.06
244 0.06
245 0.07
246 0.07
247 0.09
248 0.15
249 0.22
250 0.29
251 0.37
252 0.41
253 0.42
254 0.43
255 0.45
256 0.42
257 0.37
258 0.32
259 0.24
260 0.21
261 0.2
262 0.19
263 0.15
264 0.13
265 0.1
266 0.07
267 0.06
268 0.05
269 0.05
270 0.05
271 0.05
272 0.04
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.02
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.04
286 0.04
287 0.04
288 0.05
289 0.06
290 0.08
291 0.08
292 0.12
293 0.16
294 0.21
295 0.24
296 0.24
297 0.23
298 0.21
299 0.23
300 0.2
301 0.2
302 0.16
303 0.13
304 0.13
305 0.14
306 0.14
307 0.14
308 0.2
309 0.19
310 0.2
311 0.22
312 0.24
313 0.28
314 0.32
315 0.36
316 0.32
317 0.32
318 0.31
319 0.28
320 0.26
321 0.22
322 0.17
323 0.16
324 0.16
325 0.15
326 0.17
327 0.17
328 0.16
329 0.16
330 0.16
331 0.15
332 0.14
333 0.14
334 0.16
335 0.17
336 0.17
337 0.19
338 0.19
339 0.16
340 0.15
341 0.16
342 0.13
343 0.12
344 0.18
345 0.19
346 0.19