FuNGI

A0A139ILG4

Protein Details

Accession

A0A139ILG4

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
381-407	GQAPEMPWSRQKDRKKCKNCCYTISSA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 23, cyto 1.5, cyto_nucl 1.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036291 NAD(P)-bd_dom_sf IPR002347 SDR_fam
Pfam	View protein in Pfam PF13561 adh_short_C2

Amino Acid Sequences

MAAKSITSKFSLKGKSYIVTGGAMGIGYCITKDIAESGANVAVLDLRSEPLEDVYGLAKQFGVKADYCQADVSDEKSLKAGFEKAVQSLGKIDGIVTAAGIAIDKPFVDQKWEEVEKVLQVNAMGSFFAAQLAVKQLQKQGTGGSIVFIASITAHVNLPGYRMAGYNVSKGGVKMLSKVLSAELAPKGIRVNSISPAFIETNQTRGAREHTTKAAGDLMQTAPPMGRIGQPDEVSPAAVFFLSDAATYVTGADILVSGGIHTGRGGDYDMDKTENEAVECLVLPILNRLRFRTALIVSSKGNSIAPSSFDTSNPSEGRSLKRDRLARCHLSQREVGSQCQAFDSFHVPKSFASPLQLFSSGHPNKLFRRHPDLVEAPALHGQAPEMPWSRQKDRKKCKNCCYTISSADELYSRRLFYRSGPSIPEGQTVTYGSNPGPSSQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.44
2	0.43
3	0.43
4	0.41
5	0.34
6	0.28
7	0.24
8	0.18
9	0.15
10	0.12
11	0.1
12	0.07
13	0.06
14	0.05
15	0.05
16	0.06
17	0.06
18	0.06
19	0.06
20	0.08
21	0.1
22	0.11
23	0.12
24	0.12
25	0.13
26	0.13
27	0.13
28	0.11
29	0.11
30	0.1
31	0.1
32	0.09
33	0.08
34	0.09
35	0.1
36	0.1
37	0.1
38	0.11
39	0.1
40	0.1
41	0.11
42	0.13
43	0.12
44	0.12
45	0.11
46	0.1
47	0.12
48	0.13
49	0.16
50	0.14
51	0.17
52	0.23
53	0.24
54	0.24
55	0.23
56	0.21
57	0.2
58	0.21
59	0.2
60	0.21
61	0.2
62	0.2
63	0.21
64	0.21
65	0.19
66	0.2
67	0.2
68	0.15
69	0.2
70	0.21
71	0.2
72	0.25
73	0.24
74	0.22
75	0.22
76	0.21
77	0.16
78	0.14
79	0.13
80	0.1
81	0.1
82	0.1
83	0.07
84	0.06
85	0.05
86	0.05
87	0.05
88	0.04
89	0.04
90	0.04
91	0.04
92	0.05
93	0.08
94	0.08
95	0.13
96	0.13
97	0.16
98	0.24
99	0.26
100	0.25
101	0.24
102	0.25
103	0.23
104	0.24
105	0.21
106	0.13
107	0.12
108	0.12
109	0.11
110	0.1
111	0.07
112	0.06
113	0.06
114	0.06
115	0.06
116	0.05
117	0.04
118	0.05
119	0.09
120	0.12
121	0.12
122	0.14
123	0.18
124	0.2
125	0.21
126	0.21
127	0.18
128	0.17
129	0.17
130	0.15
131	0.12
132	0.1
133	0.09
134	0.08
135	0.07
136	0.06
137	0.04
138	0.05
139	0.05
140	0.05
141	0.06
142	0.06
143	0.07
144	0.07
145	0.08
146	0.08
147	0.08
148	0.08
149	0.08
150	0.09
151	0.13
152	0.14
153	0.14
154	0.14
155	0.14
156	0.14
157	0.13
158	0.14
159	0.12
160	0.11
161	0.12
162	0.14
163	0.14
164	0.14
165	0.14
166	0.13
167	0.11
168	0.11
169	0.12
170	0.1
171	0.1
172	0.1
173	0.1
174	0.11
175	0.1
176	0.11
177	0.1
178	0.12
179	0.14
180	0.16
181	0.15
182	0.14
183	0.17
184	0.16
185	0.14
186	0.18
187	0.14
188	0.15
189	0.18
190	0.19
191	0.17
192	0.17
193	0.2
194	0.2
195	0.22
196	0.23
197	0.21
198	0.23
199	0.23
200	0.22
201	0.2
202	0.15
203	0.13
204	0.12
205	0.11
206	0.09
207	0.09
208	0.08
209	0.07
210	0.07
211	0.07
212	0.06
213	0.08
214	0.08
215	0.11
216	0.14
217	0.15
218	0.15
219	0.16
220	0.15
221	0.13
222	0.11
223	0.09
224	0.06
225	0.05
226	0.05
227	0.03
228	0.04
229	0.04
230	0.04
231	0.04
232	0.04
233	0.05
234	0.05
235	0.05
236	0.04
237	0.04
238	0.04
239	0.03
240	0.03
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.03
247	0.03
248	0.03
249	0.04
250	0.04
251	0.04
252	0.05
253	0.06
254	0.07
255	0.09
256	0.09
257	0.1
258	0.1
259	0.11
260	0.12
261	0.12
262	0.11
263	0.1
264	0.09
265	0.08
266	0.08
267	0.07
268	0.05
269	0.05
270	0.05
271	0.1
272	0.14
273	0.18
274	0.19
275	0.21
276	0.24
277	0.25
278	0.26
279	0.27
280	0.23
281	0.24
282	0.25
283	0.25
284	0.23
285	0.23
286	0.23
287	0.18
288	0.17
289	0.12
290	0.12
291	0.11
292	0.12
293	0.14
294	0.17
295	0.17
296	0.17
297	0.21
298	0.21
299	0.26
300	0.24
301	0.23
302	0.23
303	0.25
304	0.3
305	0.33
306	0.37
307	0.37
308	0.44
309	0.49
310	0.51
311	0.57
312	0.61
313	0.61
314	0.6
315	0.64
316	0.6
317	0.58
318	0.56
319	0.5
320	0.5
321	0.46
322	0.42
323	0.37
324	0.34
325	0.31
326	0.29
327	0.26
328	0.17
329	0.17
330	0.22
331	0.2
332	0.23
333	0.24
334	0.23
335	0.23
336	0.27
337	0.28
338	0.23
339	0.25
340	0.22
341	0.23
342	0.26
343	0.28
344	0.24
345	0.23
346	0.33
347	0.29
348	0.31
349	0.32
350	0.33
351	0.37
352	0.46
353	0.52
354	0.48
355	0.56
356	0.57
357	0.56
358	0.6
359	0.57
360	0.51
361	0.49
362	0.42
363	0.34
364	0.32
365	0.3
366	0.22
367	0.19
368	0.16
369	0.14
370	0.14
371	0.18
372	0.19
373	0.2
374	0.27
375	0.34
376	0.42
377	0.49
378	0.59
379	0.64
380	0.72
381	0.81
382	0.86
383	0.89
384	0.92
385	0.94
386	0.9
387	0.86
388	0.83
389	0.78
390	0.74
391	0.68
392	0.6
393	0.49
394	0.43
395	0.39
396	0.33
397	0.31
398	0.27
399	0.23
400	0.23
401	0.24
402	0.24
403	0.27
404	0.36
405	0.37
406	0.38
407	0.41
408	0.42
409	0.47
410	0.48
411	0.46
412	0.37
413	0.31
414	0.29
415	0.27
416	0.25
417	0.2
418	0.2
419	0.16
420	0.21

A0A139ILG4

3D AlphaFold-predicted Structure Viewer