Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139IT29

Protein Details
Accession A0A139IT29    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
71-101AGLLPRIRVKTKRPKDRRRRRVYVDDAPLRYBasic
NLS Segment(s)
PositionSequence
76-91RIRVKTKRPKDRRRRR
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MSSSAGFTSTRGPANPYPYHNARPHPHARHHDPRHVHFADDLTPSALTLRIKLGPNTRPTAVIKISIYFEAGLLPRIRVKTKRPKDRRRRRVYVDDAPLRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.38
4 0.42
5 0.45
6 0.51
7 0.5
8 0.54
9 0.51
10 0.54
11 0.6
12 0.59
13 0.63
14 0.64
15 0.68
16 0.72
17 0.74
18 0.74
19 0.7
20 0.67
21 0.67
22 0.59
23 0.51
24 0.41
25 0.35
26 0.3
27 0.25
28 0.21
29 0.13
30 0.12
31 0.11
32 0.1
33 0.11
34 0.08
35 0.07
36 0.09
37 0.11
38 0.12
39 0.15
40 0.2
41 0.23
42 0.27
43 0.29
44 0.28
45 0.27
46 0.28
47 0.29
48 0.25
49 0.23
50 0.2
51 0.18
52 0.19
53 0.17
54 0.16
55 0.12
56 0.11
57 0.1
58 0.09
59 0.11
60 0.1
61 0.11
62 0.14
63 0.17
64 0.22
65 0.26
66 0.35
67 0.44
68 0.54
69 0.64
70 0.72
71 0.81
72 0.88
73 0.94
74 0.95
75 0.95
76 0.94
77 0.92
78 0.92
79 0.9
80 0.88
81 0.87