Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4US87

Protein Details
Accession E4US87    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-54GTLSNEKREGQRKKRKGEKEKRKRKRPGSASRFLSBasic
80-107LIQPAAPTPEKKKKNKKKKKVPLEKENGBasic
NLS Segment(s)
PositionSequence
24-48NEKREGQRKKRKGEKEKRKRKRPGS
89-104EKKKKNKKKKKVPLEK
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MWSLACWSLSTKSKKQRESGTLSNEKREGQRKKRKGEKEKRKRKRPGSASRFLSVLAKEGGAAHKCPLNGAAPLFLEASLIQPAAPTPEKKKKNKKKKKVPLEKENG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.72
4 0.72
5 0.72
6 0.71
7 0.7
8 0.71
9 0.67
10 0.65
11 0.58
12 0.52
13 0.5
14 0.52
15 0.53
16 0.54
17 0.63
18 0.67
19 0.76
20 0.83
21 0.87
22 0.89
23 0.9
24 0.9
25 0.9
26 0.93
27 0.94
28 0.94
29 0.94
30 0.92
31 0.92
32 0.91
33 0.91
34 0.88
35 0.86
36 0.79
37 0.7
38 0.6
39 0.5
40 0.41
41 0.29
42 0.22
43 0.13
44 0.09
45 0.08
46 0.08
47 0.11
48 0.1
49 0.11
50 0.1
51 0.12
52 0.12
53 0.12
54 0.13
55 0.11
56 0.12
57 0.11
58 0.12
59 0.1
60 0.11
61 0.11
62 0.1
63 0.09
64 0.07
65 0.08
66 0.08
67 0.07
68 0.06
69 0.06
70 0.06
71 0.11
72 0.14
73 0.17
74 0.25
75 0.36
76 0.46
77 0.56
78 0.68
79 0.74
80 0.83
81 0.9
82 0.93
83 0.94
84 0.96
85 0.97
86 0.97
87 0.96