Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IW59

Protein Details
Accession A0A139IW59    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
153-173AQYSKQKQYGHKRLKHFREFWHydrophilic
201-233MKVQIAPQSPPKKKYRRAPKFTATKKKTRTRTTHydrophilic
NLS Segment(s)
PositionSequence
210-231PPKKKYRRAPKFTATKKKTRTR
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MNEQSLQEWQAELAKLTTKHSATLPPTTPVSVVQTQVRHLSRGRVSTGNTAKQMAAISLALSSSWTVLLTGKYAVTYPKVISIYESQHDSSKGHFKVEDRSGYYQGQQRAAQGVSTDFPHEGMERHRWLKAIGNQHAVSLESLYTTTACPNWAQYSKQKQYGHKRLKHFREFWIKDGEQLPDDEGPMYQHRLGYRSVFPVMKVQIAPQSPPKKKYRRAPKFTATKKKTRTRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.22
4 0.28
5 0.25
6 0.26
7 0.28
8 0.33
9 0.32
10 0.39
11 0.38
12 0.35
13 0.36
14 0.35
15 0.33
16 0.27
17 0.29
18 0.24
19 0.24
20 0.25
21 0.25
22 0.27
23 0.34
24 0.34
25 0.3
26 0.3
27 0.35
28 0.34
29 0.36
30 0.38
31 0.34
32 0.35
33 0.42
34 0.47
35 0.44
36 0.41
37 0.38
38 0.34
39 0.32
40 0.3
41 0.2
42 0.15
43 0.1
44 0.09
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.04
53 0.05
54 0.06
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.1
63 0.11
64 0.11
65 0.14
66 0.15
67 0.15
68 0.17
69 0.19
70 0.2
71 0.2
72 0.22
73 0.18
74 0.19
75 0.2
76 0.18
77 0.18
78 0.23
79 0.22
80 0.21
81 0.22
82 0.22
83 0.28
84 0.32
85 0.33
86 0.28
87 0.3
88 0.32
89 0.31
90 0.33
91 0.3
92 0.28
93 0.27
94 0.24
95 0.22
96 0.21
97 0.21
98 0.17
99 0.13
100 0.11
101 0.09
102 0.09
103 0.09
104 0.07
105 0.07
106 0.07
107 0.07
108 0.08
109 0.1
110 0.15
111 0.18
112 0.19
113 0.2
114 0.19
115 0.2
116 0.25
117 0.28
118 0.32
119 0.32
120 0.36
121 0.35
122 0.35
123 0.34
124 0.28
125 0.23
126 0.14
127 0.11
128 0.05
129 0.05
130 0.05
131 0.06
132 0.05
133 0.06
134 0.06
135 0.07
136 0.07
137 0.09
138 0.14
139 0.16
140 0.19
141 0.27
142 0.37
143 0.41
144 0.5
145 0.53
146 0.57
147 0.66
148 0.74
149 0.76
150 0.73
151 0.77
152 0.79
153 0.84
154 0.84
155 0.77
156 0.75
157 0.75
158 0.71
159 0.65
160 0.64
161 0.54
162 0.48
163 0.48
164 0.41
165 0.3
166 0.28
167 0.26
168 0.17
169 0.18
170 0.14
171 0.11
172 0.12
173 0.14
174 0.16
175 0.15
176 0.17
177 0.18
178 0.2
179 0.22
180 0.23
181 0.24
182 0.25
183 0.28
184 0.26
185 0.26
186 0.3
187 0.3
188 0.29
189 0.26
190 0.24
191 0.27
192 0.27
193 0.3
194 0.33
195 0.42
196 0.46
197 0.54
198 0.62
199 0.66
200 0.74
201 0.81
202 0.83
203 0.83
204 0.86
205 0.88
206 0.88
207 0.88
208 0.9
209 0.9
210 0.87
211 0.86
212 0.87
213 0.87