Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IER6

Protein Details
Accession A0A139IER6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-100EGYKRDPKALKRPPKARDTKPEPBasic
NLS Segment(s)
PositionSequence
82-94RDPKALKRPPKAR
233-238KKRKAR
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017868  Filamin/ABP280_repeat-like  
PROSITE View protein in PROSITE  
PS50194  FILAMIN_REPEAT  
Amino Acid Sequences MIHSRALCFDGDVEKNRIPLAKSKVPCIATKELVNRPGQTPLKHSFHEISQRVAEPDPVAFADPAFAAPRSVVERDHEGYKRDPKALKRPPKARDTKPEPTVPRSVPLEVSFGRAEVASRDAGAAILPPRETGRPWRRVAVGTGIERVRERAFEALKFAVDLSSSFPGYLRAFIGGPGKMIHPASSPVYNLSTFRCPYTPFEALQHPMTTMIGSGESEAGPSKLHQVLRMTGKKRKARMERGAPDAATRSLQSKSSWFSGKKAYGIVFATLKQEANSGLLQKLHIPSRRWYGLDRSLPLLSIPIAMFRPQYRVVSLADLSSLEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.35
5 0.31
6 0.34
7 0.38
8 0.42
9 0.42
10 0.46
11 0.52
12 0.51
13 0.52
14 0.51
15 0.49
16 0.44
17 0.48
18 0.51
19 0.5
20 0.53
21 0.53
22 0.49
23 0.44
24 0.49
25 0.48
26 0.43
27 0.43
28 0.45
29 0.47
30 0.45
31 0.47
32 0.41
33 0.42
34 0.49
35 0.44
36 0.4
37 0.38
38 0.39
39 0.37
40 0.35
41 0.31
42 0.21
43 0.2
44 0.17
45 0.14
46 0.14
47 0.11
48 0.1
49 0.1
50 0.09
51 0.1
52 0.1
53 0.09
54 0.08
55 0.08
56 0.1
57 0.13
58 0.14
59 0.14
60 0.16
61 0.21
62 0.23
63 0.3
64 0.3
65 0.3
66 0.35
67 0.42
68 0.43
69 0.44
70 0.47
71 0.48
72 0.57
73 0.64
74 0.69
75 0.7
76 0.75
77 0.76
78 0.81
79 0.83
80 0.8
81 0.8
82 0.79
83 0.78
84 0.74
85 0.76
86 0.69
87 0.65
88 0.63
89 0.53
90 0.49
91 0.42
92 0.38
93 0.31
94 0.28
95 0.27
96 0.21
97 0.23
98 0.18
99 0.16
100 0.15
101 0.13
102 0.12
103 0.09
104 0.1
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.06
111 0.07
112 0.06
113 0.07
114 0.07
115 0.08
116 0.09
117 0.1
118 0.11
119 0.2
120 0.28
121 0.35
122 0.37
123 0.39
124 0.4
125 0.4
126 0.41
127 0.36
128 0.31
129 0.25
130 0.27
131 0.24
132 0.23
133 0.21
134 0.22
135 0.16
136 0.12
137 0.12
138 0.13
139 0.14
140 0.13
141 0.16
142 0.14
143 0.14
144 0.13
145 0.12
146 0.08
147 0.07
148 0.07
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.1
155 0.1
156 0.11
157 0.09
158 0.08
159 0.08
160 0.1
161 0.12
162 0.1
163 0.1
164 0.1
165 0.1
166 0.11
167 0.11
168 0.1
169 0.08
170 0.1
171 0.12
172 0.12
173 0.12
174 0.12
175 0.13
176 0.13
177 0.13
178 0.14
179 0.17
180 0.16
181 0.18
182 0.17
183 0.18
184 0.21
185 0.27
186 0.26
187 0.23
188 0.25
189 0.27
190 0.28
191 0.28
192 0.24
193 0.18
194 0.16
195 0.15
196 0.12
197 0.09
198 0.07
199 0.05
200 0.05
201 0.05
202 0.06
203 0.05
204 0.06
205 0.06
206 0.06
207 0.06
208 0.07
209 0.1
210 0.14
211 0.15
212 0.17
213 0.19
214 0.25
215 0.34
216 0.41
217 0.43
218 0.45
219 0.54
220 0.57
221 0.62
222 0.67
223 0.67
224 0.7
225 0.75
226 0.79
227 0.76
228 0.76
229 0.72
230 0.62
231 0.53
232 0.46
233 0.36
234 0.27
235 0.21
236 0.17
237 0.16
238 0.17
239 0.17
240 0.19
241 0.21
242 0.25
243 0.31
244 0.3
245 0.32
246 0.39
247 0.4
248 0.38
249 0.38
250 0.34
251 0.3
252 0.3
253 0.29
254 0.23
255 0.21
256 0.22
257 0.2
258 0.2
259 0.16
260 0.16
261 0.14
262 0.15
263 0.16
264 0.15
265 0.15
266 0.16
267 0.16
268 0.19
269 0.23
270 0.28
271 0.32
272 0.34
273 0.38
274 0.46
275 0.5
276 0.48
277 0.47
278 0.48
279 0.51
280 0.55
281 0.52
282 0.47
283 0.43
284 0.41
285 0.37
286 0.3
287 0.21
288 0.17
289 0.14
290 0.13
291 0.14
292 0.15
293 0.19
294 0.19
295 0.24
296 0.25
297 0.27
298 0.26
299 0.27
300 0.28
301 0.29
302 0.28
303 0.23
304 0.2