Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IB60

Protein Details
Accession A0A139IB60   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
250-284ESEPLRIKVKTKRRQRHVRKVKSKHRYTILKIKELBasic
NLS Segment(s)
PositionSequence
255-275RIKVKTKRRQRHVRKVKSKHR
Subcellular Location(s) mito 19.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MLSRTIWRTLLEFRSQQLPPIFLLPWTANLSTVSRSTEPPSTPPPTSQGSTSHMPTQSLQPRPKYGKRFNASNGQKASNASLGKLQQSLEQSLERCQASPKLPSSTNKQSPLILSRSVRDLLPVLQAQSPHYITAHIHGFPYLLTEGDTVRLPFLMHGVEPGDVIRLNRAINLGSRDLTLKAPAPGDKIKSPVTSSRHVVDPTTGSLTTHSNVMPEGAMAPHFIPHIAKGKHSYIDDRLFVCRAVVMGVESEPLRIKVKTKRRQRHVRKVKSKHRYTILKIKELRVKSVDEIGGNRIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.44
4 0.4
5 0.35
6 0.3
7 0.31
8 0.28
9 0.21
10 0.25
11 0.19
12 0.2
13 0.23
14 0.21
15 0.19
16 0.21
17 0.22
18 0.21
19 0.22
20 0.22
21 0.2
22 0.22
23 0.25
24 0.29
25 0.29
26 0.32
27 0.37
28 0.38
29 0.38
30 0.38
31 0.39
32 0.37
33 0.37
34 0.34
35 0.31
36 0.31
37 0.33
38 0.33
39 0.35
40 0.31
41 0.31
42 0.3
43 0.35
44 0.38
45 0.43
46 0.47
47 0.46
48 0.53
49 0.6
50 0.67
51 0.68
52 0.69
53 0.71
54 0.7
55 0.72
56 0.69
57 0.71
58 0.68
59 0.65
60 0.6
61 0.51
62 0.47
63 0.42
64 0.39
65 0.34
66 0.29
67 0.22
68 0.22
69 0.21
70 0.21
71 0.22
72 0.2
73 0.18
74 0.2
75 0.21
76 0.19
77 0.2
78 0.19
79 0.2
80 0.24
81 0.21
82 0.19
83 0.2
84 0.22
85 0.22
86 0.27
87 0.27
88 0.28
89 0.31
90 0.34
91 0.4
92 0.45
93 0.49
94 0.48
95 0.46
96 0.43
97 0.41
98 0.43
99 0.37
100 0.31
101 0.26
102 0.23
103 0.24
104 0.24
105 0.21
106 0.18
107 0.16
108 0.12
109 0.15
110 0.14
111 0.13
112 0.13
113 0.14
114 0.14
115 0.16
116 0.15
117 0.12
118 0.12
119 0.12
120 0.1
121 0.13
122 0.14
123 0.11
124 0.11
125 0.1
126 0.1
127 0.09
128 0.1
129 0.07
130 0.05
131 0.05
132 0.06
133 0.06
134 0.07
135 0.08
136 0.06
137 0.06
138 0.06
139 0.06
140 0.05
141 0.06
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.07
155 0.08
156 0.08
157 0.08
158 0.1
159 0.13
160 0.13
161 0.12
162 0.12
163 0.13
164 0.13
165 0.13
166 0.13
167 0.11
168 0.12
169 0.13
170 0.13
171 0.16
172 0.18
173 0.21
174 0.21
175 0.23
176 0.24
177 0.24
178 0.26
179 0.29
180 0.3
181 0.31
182 0.32
183 0.31
184 0.32
185 0.31
186 0.29
187 0.24
188 0.21
189 0.19
190 0.19
191 0.17
192 0.14
193 0.14
194 0.16
195 0.14
196 0.14
197 0.12
198 0.1
199 0.1
200 0.1
201 0.09
202 0.07
203 0.07
204 0.06
205 0.06
206 0.07
207 0.07
208 0.07
209 0.07
210 0.08
211 0.08
212 0.1
213 0.19
214 0.19
215 0.22
216 0.26
217 0.29
218 0.32
219 0.34
220 0.35
221 0.33
222 0.37
223 0.37
224 0.34
225 0.33
226 0.3
227 0.28
228 0.24
229 0.17
230 0.13
231 0.1
232 0.09
233 0.07
234 0.07
235 0.07
236 0.09
237 0.08
238 0.1
239 0.1
240 0.12
241 0.14
242 0.15
243 0.21
244 0.29
245 0.4
246 0.49
247 0.59
248 0.68
249 0.76
250 0.86
251 0.91
252 0.93
253 0.94
254 0.95
255 0.95
256 0.96
257 0.96
258 0.95
259 0.93
260 0.91
261 0.89
262 0.87
263 0.84
264 0.84
265 0.81
266 0.79
267 0.75
268 0.73
269 0.72
270 0.65
271 0.63
272 0.56
273 0.52
274 0.46
275 0.48
276 0.42
277 0.37
278 0.36
279 0.33