Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139I686

Protein Details
Accession A0A139I686    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
328-356EEEETPRKSKRPSKTPLRRKEKHGGKGAMBasic
NLS Segment(s)
PositionSequence
212-218SKRRRKT
334-353RKSKRPSKTPLRRKEKHGGK
Subcellular Location(s) nucl 10, cyto 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR008721  ORC6  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003677  F:DNA binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF05460  ORC6  
Amino Acid Sequences MPTPVELALTTLLPTVSFLPPELLALANSLLSQSRAKAAHLKPEEEIGRSYACAHIACQRLAKRLELDAEKPKPPVKPSVYKKLYAFLDGVLGTPKTPTRGVEGRRWDALNGEGTPSKTPISKNTPPTKGAATPTSGKRKRAVGEDEAEKTPRQSTNKEQYVDGLPTSVSTTARKICKSTSTSKAVPHILVGVRAVKAEIESRAAPEPESGSKRRRKTPQSAKAAAPTETKIEIKWPALILALHTITCARMRGLPISDSSVHAMKREGMEGVVEGYVGGKRQLEGDIGFYILEAEDSGWLEMEWYTNVPESIEDWQDEAELDEEEDGEEEETPRKSKRPSKTPLRRKEKHGGKGAMDIDGGRFNAAGLQNGLGTMFQPAVDWLSEERREEYRVWKRGILKGIEEIEAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.13
5 0.13
6 0.14
7 0.15
8 0.15
9 0.15
10 0.12
11 0.11
12 0.11
13 0.11
14 0.09
15 0.09
16 0.09
17 0.08
18 0.1
19 0.11
20 0.11
21 0.17
22 0.18
23 0.2
24 0.29
25 0.32
26 0.4
27 0.43
28 0.44
29 0.39
30 0.46
31 0.46
32 0.38
33 0.37
34 0.28
35 0.25
36 0.23
37 0.24
38 0.18
39 0.18
40 0.16
41 0.16
42 0.21
43 0.24
44 0.25
45 0.31
46 0.33
47 0.38
48 0.39
49 0.41
50 0.37
51 0.35
52 0.4
53 0.38
54 0.4
55 0.42
56 0.46
57 0.45
58 0.46
59 0.46
60 0.44
61 0.44
62 0.48
63 0.46
64 0.52
65 0.57
66 0.64
67 0.65
68 0.65
69 0.63
70 0.6
71 0.53
72 0.45
73 0.38
74 0.27
75 0.25
76 0.2
77 0.2
78 0.14
79 0.13
80 0.11
81 0.12
82 0.12
83 0.12
84 0.14
85 0.14
86 0.19
87 0.27
88 0.31
89 0.38
90 0.45
91 0.46
92 0.48
93 0.48
94 0.41
95 0.35
96 0.33
97 0.28
98 0.2
99 0.19
100 0.17
101 0.18
102 0.19
103 0.19
104 0.17
105 0.17
106 0.18
107 0.23
108 0.3
109 0.36
110 0.45
111 0.53
112 0.56
113 0.54
114 0.55
115 0.51
116 0.46
117 0.42
118 0.35
119 0.29
120 0.3
121 0.36
122 0.45
123 0.45
124 0.45
125 0.45
126 0.48
127 0.48
128 0.49
129 0.47
130 0.42
131 0.43
132 0.44
133 0.44
134 0.4
135 0.38
136 0.31
137 0.27
138 0.25
139 0.24
140 0.24
141 0.25
142 0.33
143 0.42
144 0.48
145 0.49
146 0.45
147 0.43
148 0.42
149 0.38
150 0.29
151 0.19
152 0.12
153 0.11
154 0.12
155 0.1
156 0.08
157 0.08
158 0.11
159 0.16
160 0.2
161 0.21
162 0.22
163 0.22
164 0.28
165 0.32
166 0.36
167 0.38
168 0.4
169 0.42
170 0.42
171 0.45
172 0.4
173 0.35
174 0.28
175 0.24
176 0.18
177 0.16
178 0.14
179 0.11
180 0.1
181 0.1
182 0.1
183 0.07
184 0.07
185 0.08
186 0.08
187 0.08
188 0.08
189 0.1
190 0.11
191 0.12
192 0.11
193 0.1
194 0.11
195 0.13
196 0.18
197 0.2
198 0.27
199 0.34
200 0.4
201 0.47
202 0.54
203 0.58
204 0.65
205 0.72
206 0.74
207 0.76
208 0.75
209 0.68
210 0.65
211 0.59
212 0.5
213 0.4
214 0.31
215 0.23
216 0.21
217 0.2
218 0.14
219 0.15
220 0.16
221 0.15
222 0.15
223 0.13
224 0.12
225 0.13
226 0.12
227 0.1
228 0.1
229 0.1
230 0.08
231 0.08
232 0.08
233 0.08
234 0.09
235 0.09
236 0.07
237 0.09
238 0.1
239 0.13
240 0.15
241 0.15
242 0.15
243 0.18
244 0.18
245 0.17
246 0.18
247 0.18
248 0.16
249 0.16
250 0.16
251 0.15
252 0.15
253 0.15
254 0.13
255 0.1
256 0.1
257 0.09
258 0.09
259 0.07
260 0.06
261 0.05
262 0.05
263 0.06
264 0.06
265 0.06
266 0.06
267 0.06
268 0.07
269 0.08
270 0.09
271 0.09
272 0.11
273 0.11
274 0.11
275 0.1
276 0.09
277 0.08
278 0.07
279 0.06
280 0.04
281 0.04
282 0.04
283 0.05
284 0.05
285 0.05
286 0.05
287 0.06
288 0.06
289 0.06
290 0.06
291 0.06
292 0.07
293 0.08
294 0.08
295 0.08
296 0.08
297 0.09
298 0.12
299 0.13
300 0.12
301 0.12
302 0.12
303 0.12
304 0.12
305 0.11
306 0.08
307 0.07
308 0.06
309 0.06
310 0.06
311 0.06
312 0.06
313 0.06
314 0.05
315 0.06
316 0.07
317 0.1
318 0.12
319 0.15
320 0.17
321 0.22
322 0.3
323 0.39
324 0.48
325 0.56
326 0.64
327 0.73
328 0.82
329 0.88
330 0.9
331 0.92
332 0.89
333 0.87
334 0.87
335 0.86
336 0.84
337 0.83
338 0.78
339 0.69
340 0.7
341 0.62
342 0.53
343 0.43
344 0.34
345 0.25
346 0.22
347 0.2
348 0.12
349 0.11
350 0.09
351 0.14
352 0.15
353 0.15
354 0.13
355 0.14
356 0.13
357 0.14
358 0.14
359 0.09
360 0.08
361 0.08
362 0.07
363 0.06
364 0.06
365 0.07
366 0.09
367 0.09
368 0.1
369 0.12
370 0.19
371 0.22
372 0.24
373 0.27
374 0.28
375 0.31
376 0.33
377 0.41
378 0.44
379 0.49
380 0.51
381 0.54
382 0.57
383 0.62
384 0.67
385 0.6
386 0.53
387 0.52
388 0.5
389 0.45