Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UU55

Protein Details
Accession E4UU55   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
77-100KKNGTSSKPKTPRKSPTKPKTNGAHydrophilic
NLS Segment(s)
PositionSequence
77-114KKNGTSSKPKTPRKSPTKPKTNGAPKTPTKRKTNKGGA
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSRVTAEETNIFLIKCIKHSNNGKVDFASVAEECGIVSKGAAAKRYERILKGNGIHPSSSEGGDEDGAPGSANVTPKKNGTSSKPKTPRKSPTKPKTNGAPKTPTKRKTNKGGANNESPTKKFKSEEKVSDSDASVKAENDEGEDGLPLRTKNDPFLPAPAVDKENEDAMFKEFCDTGAPVKNEKEMIENQVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.29
4 0.28
5 0.36
6 0.45
7 0.53
8 0.57
9 0.6
10 0.57
11 0.5
12 0.48
13 0.4
14 0.32
15 0.26
16 0.16
17 0.13
18 0.11
19 0.1
20 0.09
21 0.1
22 0.1
23 0.07
24 0.06
25 0.08
26 0.11
27 0.13
28 0.17
29 0.18
30 0.21
31 0.25
32 0.31
33 0.34
34 0.33
35 0.35
36 0.36
37 0.39
38 0.38
39 0.4
40 0.39
41 0.36
42 0.34
43 0.3
44 0.3
45 0.25
46 0.22
47 0.17
48 0.12
49 0.11
50 0.11
51 0.11
52 0.08
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.07
59 0.09
60 0.11
61 0.13
62 0.14
63 0.16
64 0.18
65 0.2
66 0.22
67 0.26
68 0.35
69 0.39
70 0.48
71 0.57
72 0.64
73 0.68
74 0.73
75 0.77
76 0.76
77 0.81
78 0.81
79 0.82
80 0.84
81 0.8
82 0.76
83 0.76
84 0.75
85 0.7
86 0.64
87 0.62
88 0.57
89 0.64
90 0.68
91 0.65
92 0.65
93 0.68
94 0.69
95 0.71
96 0.75
97 0.73
98 0.74
99 0.75
100 0.71
101 0.68
102 0.64
103 0.58
104 0.5
105 0.43
106 0.39
107 0.33
108 0.31
109 0.27
110 0.31
111 0.37
112 0.43
113 0.49
114 0.51
115 0.5
116 0.5
117 0.49
118 0.43
119 0.37
120 0.3
121 0.25
122 0.19
123 0.17
124 0.15
125 0.14
126 0.14
127 0.12
128 0.11
129 0.09
130 0.09
131 0.09
132 0.09
133 0.08
134 0.1
135 0.09
136 0.1
137 0.15
138 0.15
139 0.2
140 0.23
141 0.27
142 0.26
143 0.3
144 0.31
145 0.27
146 0.29
147 0.28
148 0.25
149 0.22
150 0.23
151 0.2
152 0.2
153 0.2
154 0.18
155 0.16
156 0.17
157 0.17
158 0.15
159 0.16
160 0.13
161 0.13
162 0.15
163 0.15
164 0.18
165 0.25
166 0.28
167 0.3
168 0.32
169 0.35
170 0.33
171 0.33
172 0.33
173 0.28