Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139IBN5

Protein Details
Accession A0A139IBN5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
76-101GPVSAKKPGKVKRRQREERAQREGEQBasic
NLS Segment(s)
PositionSequence
79-94SAKKPGKVKRRQREER
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MAQSEPESHNKPCTICGTPRGVLVRCTIDESQKWNMVCPGSCWRSVSGGVDDAKGLEGQYPHYRYGGMWKNKHADGPVSAKKPGKVKRRQREERAQREGEQQNTHENAEGGQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.38
4 0.39
5 0.37
6 0.41
7 0.42
8 0.37
9 0.34
10 0.33
11 0.3
12 0.25
13 0.28
14 0.25
15 0.25
16 0.25
17 0.28
18 0.3
19 0.3
20 0.3
21 0.26
22 0.27
23 0.25
24 0.23
25 0.22
26 0.26
27 0.24
28 0.25
29 0.25
30 0.24
31 0.24
32 0.24
33 0.23
34 0.16
35 0.16
36 0.16
37 0.15
38 0.14
39 0.12
40 0.11
41 0.09
42 0.08
43 0.06
44 0.05
45 0.08
46 0.13
47 0.15
48 0.16
49 0.16
50 0.16
51 0.15
52 0.23
53 0.3
54 0.33
55 0.34
56 0.37
57 0.41
58 0.42
59 0.43
60 0.36
61 0.29
62 0.25
63 0.3
64 0.33
65 0.31
66 0.35
67 0.35
68 0.38
69 0.44
70 0.49
71 0.51
72 0.55
73 0.64
74 0.71
75 0.8
76 0.87
77 0.88
78 0.91
79 0.92
80 0.92
81 0.9
82 0.83
83 0.75
84 0.74
85 0.71
86 0.66
87 0.59
88 0.51
89 0.49
90 0.47
91 0.45
92 0.37
93 0.3