Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139I7J5

Protein Details
Accession A0A139I7J5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-96YRRPHVPTSRQQRRDEQRRARKEMLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 8, plas 4, E.R. 2
Family & Domain DBs
Amino Acid Sequences MARHARSKQPKAMAKLVSLIGVFALLLAVVTAFEPENHVQATLPLSVGGATLIALPFSQKFQTAMDPDSAYRRPHVPTSRQQRRDEQRRARKEMLAEIKTGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.45
4 0.36
5 0.28
6 0.21
7 0.13
8 0.11
9 0.09
10 0.05
11 0.04
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.03
19 0.03
20 0.04
21 0.07
22 0.08
23 0.09
24 0.09
25 0.1
26 0.09
27 0.1
28 0.11
29 0.08
30 0.08
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.07
48 0.08
49 0.13
50 0.14
51 0.15
52 0.16
53 0.16
54 0.17
55 0.21
56 0.23
57 0.2
58 0.2
59 0.21
60 0.22
61 0.29
62 0.36
63 0.39
64 0.46
65 0.56
66 0.65
67 0.7
68 0.73
69 0.75
70 0.79
71 0.82
72 0.83
73 0.83
74 0.83
75 0.85
76 0.89
77 0.83
78 0.76
79 0.7
80 0.69
81 0.68
82 0.59