Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5R3E8

Protein Details
Accession E5R3E8   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-37TLQPRLDTSAQRRRRRRRTTWKTPDGVGHydrophilic
NLS Segment(s)
PositionSequence
21-27RRRRRRR
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MASTSLRPATLQPRLDTSAQRRRRRRRTTWKTPDGVGAAAEEETHPSRTLRRSLHLLSILASYSFSRASWSDDQQPFLSTFLSSCDGLAKGDSHRYHLFSFPRLYAEYQQSFFTLTAIDVRSIDDPLIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.46
4 0.47
5 0.49
6 0.56
7 0.64
8 0.7
9 0.77
10 0.85
11 0.88
12 0.9
13 0.91
14 0.92
15 0.93
16 0.94
17 0.92
18 0.84
19 0.75
20 0.68
21 0.58
22 0.47
23 0.36
24 0.25
25 0.16
26 0.12
27 0.11
28 0.07
29 0.08
30 0.09
31 0.1
32 0.1
33 0.1
34 0.14
35 0.18
36 0.24
37 0.24
38 0.26
39 0.3
40 0.31
41 0.34
42 0.32
43 0.29
44 0.23
45 0.21
46 0.18
47 0.13
48 0.11
49 0.07
50 0.06
51 0.06
52 0.05
53 0.07
54 0.07
55 0.12
56 0.15
57 0.17
58 0.25
59 0.26
60 0.28
61 0.27
62 0.28
63 0.23
64 0.21
65 0.19
66 0.1
67 0.09
68 0.09
69 0.11
70 0.1
71 0.09
72 0.1
73 0.1
74 0.1
75 0.11
76 0.1
77 0.1
78 0.17
79 0.18
80 0.22
81 0.24
82 0.26
83 0.27
84 0.32
85 0.33
86 0.3
87 0.32
88 0.28
89 0.29
90 0.28
91 0.29
92 0.29
93 0.33
94 0.33
95 0.31
96 0.31
97 0.28
98 0.28
99 0.25
100 0.2
101 0.13
102 0.1
103 0.13
104 0.13
105 0.14
106 0.12
107 0.14
108 0.15
109 0.16