Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HP07

Protein Details
Accession A0A139HP07    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MANQVQKEKITKKRRQKRQKSITTLLRLPHydrophilic
NLS Segment(s)
PositionSequence
9-19KITKKRRQKRQ
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MANQVQKEKITKKRRQKRQKSITTLLRLPSNPHDRLQALHVRLGLPRPEIHVIEEKRYRAVIEGGEEEEEVWHTTAKKAKFYAAVQACPGLEEKLVEKVRREEGEGHGAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.9
3 0.93
4 0.94
5 0.94
6 0.95
7 0.93
8 0.91
9 0.89
10 0.85
11 0.77
12 0.69
13 0.62
14 0.52
15 0.46
16 0.46
17 0.44
18 0.39
19 0.36
20 0.37
21 0.33
22 0.34
23 0.35
24 0.32
25 0.26
26 0.26
27 0.25
28 0.22
29 0.22
30 0.24
31 0.2
32 0.15
33 0.14
34 0.16
35 0.17
36 0.17
37 0.18
38 0.23
39 0.22
40 0.26
41 0.29
42 0.26
43 0.25
44 0.25
45 0.23
46 0.16
47 0.17
48 0.12
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.1
55 0.08
56 0.08
57 0.07
58 0.06
59 0.07
60 0.07
61 0.1
62 0.16
63 0.18
64 0.21
65 0.21
66 0.24
67 0.28
68 0.28
69 0.35
70 0.34
71 0.34
72 0.3
73 0.31
74 0.28
75 0.24
76 0.24
77 0.15
78 0.11
79 0.11
80 0.11
81 0.19
82 0.24
83 0.26
84 0.28
85 0.33
86 0.4
87 0.4
88 0.43
89 0.37
90 0.38
91 0.44