Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139I0T1

Protein Details
Accession A0A139I0T1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-70NYRLKTLNKKLNKKLNKKLKKQLRKIKTVEPGLHydrophilic
NLS Segment(s)
PositionSequence
45-64NKKLNKKLNKKLKKQLRKIK
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MASDSPTSSAGSAVTSAAATEYAFYEQCAENVRLKAENYRLKTLNKKLNKKLNKKLKKQLRKIKTVEPGLTNGVGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.06
9 0.07
10 0.07
11 0.07
12 0.09
13 0.09
14 0.1
15 0.13
16 0.14
17 0.17
18 0.18
19 0.19
20 0.18
21 0.18
22 0.21
23 0.25
24 0.29
25 0.29
26 0.33
27 0.34
28 0.36
29 0.44
30 0.48
31 0.5
32 0.53
33 0.59
34 0.63
35 0.71
36 0.78
37 0.8
38 0.82
39 0.84
40 0.85
41 0.86
42 0.88
43 0.89
44 0.89
45 0.9
46 0.91
47 0.89
48 0.88
49 0.84
50 0.83
51 0.81
52 0.78
53 0.72
54 0.64
55 0.57
56 0.51