Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IGS5

Protein Details
Accession A0A139IGS5    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
359-381DKFGKKVQPLMKSRKGRNVPTSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 8, cyto 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011251  Luciferase-like_dom  
IPR036661  Luciferase-like_sf  
IPR019914  Pyrimidine_monooxygenase_RutA  
Gene Ontology GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0006212  P:uracil catabolic process  
Pfam View protein in Pfam  
PF00296  Bac_luciferase  
CDD cd01094  Alkanesulfonate_monoxygenase  
Amino Acid Sequences MVDIGVFIPIGKLRMLSRLCFQDSRTSTGNNGWLISSTAPQYKPSYALNKAIVQKAESYNLDFALSMIKLRGFGGKTEFWDHNLESFTLMSALAAVTTKIKLFASTAVLTLPPALVARMATTIDSIAPGRFGVNIVTGWQQAEYSQMGLWPGDKYFGYRYDYAMEYVQVMKDLWLTGASNFKGKYFQMEDCKLSPRPVNNGVQIVAAGQSARGIEFASQYADYNFALGTGFNTPTAYAEATVRLVEAAEKTGRDVGSMVLFMVILEETDQEAEEKWENYKAGVDVEAVAWMAGQSGKDVKADSKSTAHFLGLPDGAVNMNLGTLVGAYEKVASMLDEVASVPGTKGIMLVFDDFLEGLDKFGKKVQPLMKSRKGRNVPTSAACCDLHDTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.25
4 0.3
5 0.36
6 0.41
7 0.41
8 0.42
9 0.44
10 0.44
11 0.47
12 0.44
13 0.39
14 0.36
15 0.39
16 0.42
17 0.32
18 0.3
19 0.24
20 0.22
21 0.22
22 0.21
23 0.18
24 0.17
25 0.21
26 0.22
27 0.25
28 0.28
29 0.28
30 0.3
31 0.34
32 0.38
33 0.36
34 0.41
35 0.42
36 0.45
37 0.48
38 0.5
39 0.45
40 0.39
41 0.39
42 0.36
43 0.37
44 0.31
45 0.29
46 0.26
47 0.25
48 0.24
49 0.19
50 0.16
51 0.14
52 0.13
53 0.11
54 0.1
55 0.1
56 0.11
57 0.11
58 0.17
59 0.14
60 0.16
61 0.21
62 0.22
63 0.25
64 0.29
65 0.29
66 0.27
67 0.3
68 0.28
69 0.26
70 0.25
71 0.22
72 0.18
73 0.17
74 0.15
75 0.11
76 0.1
77 0.07
78 0.06
79 0.05
80 0.04
81 0.05
82 0.05
83 0.06
84 0.07
85 0.07
86 0.08
87 0.09
88 0.09
89 0.1
90 0.12
91 0.15
92 0.15
93 0.15
94 0.14
95 0.14
96 0.13
97 0.12
98 0.1
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.06
114 0.07
115 0.07
116 0.07
117 0.06
118 0.07
119 0.06
120 0.07
121 0.07
122 0.08
123 0.09
124 0.09
125 0.09
126 0.09
127 0.08
128 0.07
129 0.09
130 0.08
131 0.07
132 0.07
133 0.07
134 0.08
135 0.08
136 0.09
137 0.07
138 0.07
139 0.08
140 0.08
141 0.09
142 0.11
143 0.15
144 0.17
145 0.17
146 0.18
147 0.19
148 0.2
149 0.2
150 0.18
151 0.14
152 0.12
153 0.12
154 0.1
155 0.08
156 0.08
157 0.07
158 0.07
159 0.06
160 0.06
161 0.05
162 0.06
163 0.06
164 0.11
165 0.11
166 0.13
167 0.13
168 0.13
169 0.15
170 0.14
171 0.18
172 0.17
173 0.21
174 0.25
175 0.27
176 0.29
177 0.29
178 0.33
179 0.29
180 0.28
181 0.27
182 0.22
183 0.25
184 0.28
185 0.29
186 0.27
187 0.27
188 0.26
189 0.23
190 0.2
191 0.15
192 0.11
193 0.07
194 0.05
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.05
203 0.06
204 0.07
205 0.07
206 0.07
207 0.07
208 0.08
209 0.08
210 0.07
211 0.07
212 0.05
213 0.05
214 0.05
215 0.06
216 0.06
217 0.07
218 0.07
219 0.07
220 0.07
221 0.08
222 0.09
223 0.08
224 0.07
225 0.07
226 0.08
227 0.08
228 0.08
229 0.07
230 0.06
231 0.06
232 0.06
233 0.06
234 0.08
235 0.08
236 0.08
237 0.09
238 0.12
239 0.12
240 0.11
241 0.11
242 0.1
243 0.1
244 0.1
245 0.09
246 0.06
247 0.06
248 0.05
249 0.05
250 0.04
251 0.03
252 0.04
253 0.04
254 0.04
255 0.04
256 0.05
257 0.05
258 0.05
259 0.08
260 0.09
261 0.1
262 0.11
263 0.14
264 0.14
265 0.14
266 0.15
267 0.14
268 0.13
269 0.13
270 0.12
271 0.09
272 0.09
273 0.09
274 0.07
275 0.06
276 0.05
277 0.04
278 0.05
279 0.05
280 0.05
281 0.06
282 0.08
283 0.09
284 0.1
285 0.11
286 0.14
287 0.18
288 0.21
289 0.22
290 0.24
291 0.25
292 0.28
293 0.28
294 0.26
295 0.22
296 0.21
297 0.22
298 0.18
299 0.16
300 0.13
301 0.13
302 0.12
303 0.1
304 0.09
305 0.05
306 0.05
307 0.04
308 0.04
309 0.04
310 0.03
311 0.04
312 0.04
313 0.04
314 0.05
315 0.05
316 0.05
317 0.06
318 0.06
319 0.06
320 0.07
321 0.07
322 0.07
323 0.07
324 0.07
325 0.07
326 0.08
327 0.08
328 0.07
329 0.07
330 0.08
331 0.07
332 0.07
333 0.07
334 0.08
335 0.09
336 0.11
337 0.1
338 0.1
339 0.1
340 0.1
341 0.1
342 0.11
343 0.09
344 0.08
345 0.13
346 0.14
347 0.14
348 0.2
349 0.24
350 0.23
351 0.32
352 0.38
353 0.43
354 0.53
355 0.62
356 0.67
357 0.72
358 0.78
359 0.8
360 0.82
361 0.81
362 0.81
363 0.79
364 0.75
365 0.74
366 0.72
367 0.64
368 0.59
369 0.5
370 0.43