Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139IL88

Protein Details
Accession A0A139IL88    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-35RLETRRLEQRYARRDKRRTSVPNIQYHydrophilic
NLS Segment(s)
PositionSequence
58-70RARRRSLAPRPRR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGLIDKIRSRLETRRLEQRYARRDKRRTSVPNIQYVDGEYVLSDLSSTGRDLNPAANRARRRSLAPRPRRASLYGRDSIIPDCPQETAARPKARNRESVVLRYMSEPEEETCTYRRQSYRPPPRTRDSVVLRNMDYLPGEETRSKRQPRNRESIVLGNMLVEDTPSGRTRPPPRNRDSIVMRGMAEWTDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.66
4 0.69
5 0.71
6 0.72
7 0.73
8 0.78
9 0.78
10 0.82
11 0.84
12 0.84
13 0.85
14 0.83
15 0.81
16 0.81
17 0.77
18 0.77
19 0.72
20 0.63
21 0.53
22 0.46
23 0.39
24 0.28
25 0.22
26 0.12
27 0.1
28 0.09
29 0.08
30 0.06
31 0.04
32 0.04
33 0.05
34 0.06
35 0.08
36 0.08
37 0.09
38 0.1
39 0.15
40 0.18
41 0.21
42 0.25
43 0.3
44 0.34
45 0.38
46 0.43
47 0.39
48 0.42
49 0.47
50 0.54
51 0.58
52 0.64
53 0.69
54 0.69
55 0.7
56 0.68
57 0.63
58 0.58
59 0.55
60 0.51
61 0.43
62 0.4
63 0.37
64 0.35
65 0.31
66 0.28
67 0.21
68 0.14
69 0.12
70 0.11
71 0.11
72 0.11
73 0.13
74 0.18
75 0.24
76 0.29
77 0.31
78 0.36
79 0.45
80 0.47
81 0.49
82 0.46
83 0.46
84 0.44
85 0.46
86 0.43
87 0.35
88 0.32
89 0.28
90 0.25
91 0.17
92 0.15
93 0.12
94 0.1
95 0.13
96 0.13
97 0.14
98 0.14
99 0.16
100 0.17
101 0.21
102 0.23
103 0.23
104 0.33
105 0.43
106 0.52
107 0.6
108 0.68
109 0.69
110 0.72
111 0.75
112 0.68
113 0.66
114 0.61
115 0.59
116 0.56
117 0.52
118 0.47
119 0.43
120 0.4
121 0.32
122 0.25
123 0.18
124 0.15
125 0.13
126 0.15
127 0.17
128 0.19
129 0.27
130 0.36
131 0.42
132 0.48
133 0.56
134 0.65
135 0.69
136 0.76
137 0.73
138 0.69
139 0.66
140 0.65
141 0.58
142 0.49
143 0.4
144 0.3
145 0.25
146 0.2
147 0.15
148 0.08
149 0.06
150 0.05
151 0.09
152 0.1
153 0.12
154 0.14
155 0.23
156 0.33
157 0.43
158 0.53
159 0.6
160 0.65
161 0.73
162 0.75
163 0.75
164 0.72
165 0.7
166 0.63
167 0.56
168 0.5
169 0.41
170 0.38