Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139IAK8

Protein Details
Accession A0A139IAK8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-94RGYRVDPYEKPRKKTKIKKETWBasic
NLS Segment(s)
PositionSequence
82-91KPRKKTKIKK
Subcellular Location(s) mito 7, cyto 5.5, E.R. 5, cyto_nucl 3.5, plas 3, extr 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAIRREALVHVLPTPPSIHLTTPNPTEEYTQQLVALLVPVVLVLALVALVAYGGAYHGTLGFGEEFSAEMKDRGYRVDPYEKPRKKTKIKKETW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.17
4 0.17
5 0.17
6 0.2
7 0.24
8 0.27
9 0.28
10 0.29
11 0.27
12 0.26
13 0.28
14 0.24
15 0.26
16 0.23
17 0.21
18 0.19
19 0.18
20 0.17
21 0.13
22 0.12
23 0.06
24 0.04
25 0.04
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.01
32 0.01
33 0.01
34 0.01
35 0.01
36 0.01
37 0.01
38 0.01
39 0.01
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.07
55 0.06
56 0.07
57 0.08
58 0.1
59 0.1
60 0.13
61 0.16
62 0.18
63 0.23
64 0.33
65 0.37
66 0.44
67 0.55
68 0.59
69 0.62
70 0.68
71 0.73
72 0.75
73 0.81
74 0.83