Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HV82

Protein Details
Accession A0A139HV82   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPPTRASKSKRRADKFAPWHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 8, extr 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPTRASKSKRRADKFAPWHWVAIGFGIPVIIGLLFYYTFGRLRFWQSHETTPHTPPATGARRLTTYYEYEIVDGQLVPIEVTVPDPFHEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.78
4 0.76
5 0.66
6 0.6
7 0.52
8 0.45
9 0.34
10 0.25
11 0.17
12 0.09
13 0.07
14 0.06
15 0.06
16 0.04
17 0.04
18 0.03
19 0.02
20 0.02
21 0.03
22 0.03
23 0.04
24 0.04
25 0.05
26 0.07
27 0.07
28 0.09
29 0.1
30 0.15
31 0.18
32 0.2
33 0.26
34 0.27
35 0.32
36 0.33
37 0.38
38 0.36
39 0.35
40 0.37
41 0.31
42 0.29
43 0.25
44 0.3
45 0.3
46 0.31
47 0.31
48 0.28
49 0.29
50 0.31
51 0.33
52 0.27
53 0.24
54 0.23
55 0.24
56 0.22
57 0.21
58 0.2
59 0.17
60 0.15
61 0.12
62 0.09
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.05
69 0.08
70 0.09
71 0.09